KEGG   Rattus norvegicus (rat): 310864
Entry
310864            CDS       T01003                                 

Gene name
Manba
Definition
(RefSeq) beta-mannosidase precursor
  KO
K01192  beta-mannosidase [EC:3.2.1.25]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00511  Other glycan degradation
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    310864 (Manba)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    310864 (Manba)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.25  beta-mannosidase
     310864 (Manba)
SSDB
Motif
Pfam: Ig_mannosidase Mannosidase_ig Glyco_hydro_2_C Glyco_hydro_2_N
Other DBs
NCBI-GeneID: 310864
NCBI-ProteinID: NP_001026825
RGD: 1305785
Ensembl: ENSRNOG00000052247
UniProt: Q4FZV0
Position
2
AA seq 881 aa
MHLHLLFLLALCGAGCMAAGPSYSLRGSWRVSNGNSSLELPATVPGYVHSALQQHGLIQD
PYYRFNDLNYRWISLDNWTYSTEFKIPFNRSEWQKVKLIFDGVDTVAEILFNNVTIGKTD
NMFTRYSFDVTNVVKDVNSLKLRFQSAVQYAECQSKAHTQYRVPPECPPVEQKGECHVNF
IRKEQCSFSWDWGPSFPSQGIWKDVRIEAYNIAHLDHLTFLPLYDNTSQAWTIEIEASFD
VVSTKPVGGQVTIAIPELKTQQANHIELQHGQRIVKLLVKIRKDVTVETWWPHGHGNQTG
YNTTILFALDGGLKIEKAAKVYFRTVQLIEEPITGSPGLSFYFKINGLPIFLKGSNWIPA
DSFQDKVTSELLQLLLQSAVDANMNTLRVWGGGIYEQDEFYALCDELGIMVWQDFMFASA
LYPTEPGFLESVRKEVTYQVRRLKSHPSVIIWSGNNENEVALRVNWFHVNPRDLGTYIND
YVTLYVKTIREIVLSEDRSRPFIASSPTNGVKTMTEGWISKDPYSTQYGDMHFYDYFSDC
WDWKVFPKARLVSEYGYQSWPSFSTLQKVSRQEDWSYSSRFSLHRQHHGNGNNEMLHQVQ
LHFQLPQRRDPVRAFKDTIYLTQVMQAQCIKTETEFYLRSRSEIVNGEGHTMGALYWQLN
DIWQAPSWASLEYGGKWKMLHYFAQRFFAPLLPVGFEDEGVFYVYGVSDLHKDYPTKLTV
RLHRWSSQKPLCTFVSLSAVIKAGEAMVLFQMPVSKLLKRCKECTRDTCVVSFYLSTDNE
LFSPTNYHFLSSLKDAKGMVKANITVSISQKGDLFVFDLKSSTSAITPFVWLDVGSIPGR
FSDNGFLMIKKELSVLFYPWKPTSKSELQQAFSVTSLTDLY
NT seq 2646 nt   +upstreamnt  +downstreamnt
atgcatctccacctgctctttctgttggcgctgtgcggggcaggctgtatggccgcaggt
cccagctacagcctgagagggagctggcgggtgagcaacgggaatagttccctggagctg
ccggctactgtccctggctatgtgcacagcgccctgcagcagcacgggctgatccaggat
ccttactacagatttaatgacctgaactacagatggatttccttagataactggacctac
agcacagaatttaaaatcccctttaatcgcagtgaatggcagaaggtaaagttgattttt
gacggagtcgatacagttgcagaaatcctgttcaataatgtcactattgggaagacagac
aacatgttcaccagatatagctttgacgtcaccaatgtggtcaaagacgtgaactcccta
aagctgcggttccagtcagcagtgcagtatgctgagtgtcagagcaaagctcacactcaa
taccgggtgcccccagagtgccccccagtggaacagaagggtgaatgccacgtcaacttc
atccgaaaggagcagtgctccttcagctgggactgggggccttcctttccctctcaagga
atctggaaagacgttagaatcgaagcctataacatcgctcatctggatcacctgacattt
ttgccattgtatgataacacttctcaggcgtggactattgaaatagaggcttcttttgat
gttgtcagcacaaagccagttggtggtcaggtgactatagccatccccgaactgaaaaca
cagcaggcaaaccacattgaacttcaacatgggcaaaggattgttaaactccttgtcaaa
attaggaaggacgtcaccgtggagacctggtggcctcatggacatgggaaccagactggg
tacaacacgacaattctctttgcgctggatggaggcttaaaaattgaaaaagcagccaag
gtttatttcagaacagtgcaacttatagaagaacctataacagggtctcctggtctgagt
ttctacttcaaaattaatgggcttcctatatttctgaaaggctcaaactggatcccagct
gactcattccaagacaaagtcacttctgaactgctgcagctccttctccagtccgccgtg
gatgctaacatgaacactctgcgcgtgtgggggggtggcatctacgagcaggatgaattc
tatgcactgtgtgacgaacttggaataatggtgtggcaggacttcatgtttgccagtgcc
ctctatccaactgagccaggcttcctagagtcagtgagaaaagaagtcacttaccaggtc
aggagactgaagtctcacccctccgtcatcatctggagtggtaataatgagaatgaagtg
gctctcagggtgaactggttccatgtaaaccccagggacctggggacttacatcaacgac
tatgtgaccctctacgtgaaaaccatcagggagattgtcttatcggaagataggagtcgt
ccgttcattgcatccagcccaaccaatggggtcaaaaccatgacggaaggctggatctct
aaggacccttatagcacccagtatggcgacatgcatttttacgactatttcagtgactgc
tgggactggaaggtctttccaaaagctcgattagtgtctgaatatggctaccagtcctgg
ccttccttcagcacactacaaaaggtctctcgtcaagaggactggtcttacagcagccgc
ttctcccttcatcggcagcatcatggaaatggcaacaatgaaatgcttcaccaggtacag
cttcatttccaactcccccaaaggagagacccagtgcgtgcatttaaagataccatctac
ctcactcaggtgatgcaggcccagtgtatcaaaacagaaaccgagttctacctgcgcagc
cgcagcgagatagtgaatggagaaggccacaccatgggggcactgtactggcagctgaat
gatatctggcaggctccttcctgggcctctcttgagtacggagggaaatggaaaatgctt
cattacttcgctcagcgtttcttcgctccgctgctgccagtcggttttgaagatgaaggc
gttttttatgtctacggtgtgtcagatcttcacaaggactaccccacaaagctcaccgtg
aggctccaccgctggagctcccagaagcctttgtgcaccttcgtgagtttgagtgctgtg
attaaggcaggggaggcgatggttctgttccagatgccagtgtctaagctgctgaagagg
tgtaaagaatgcacaagggacacctgtgtggtttccttttacctctcaactgacaatgaa
ctcttcagtccaaccaactaccatttcctgtcctccctgaaggatgccaaagggatggtc
aaggccaacatcactgtcagcatctctcagaagggtgatctatttgtttttgatctgaaa
tcgtcaacatcagccatcactccctttgtttggttggatgtaggaagcatcccggggaga
tttagtgacaacggcttcctcatgattaagaaggagctctcggtactgttttacccatgg
aagcccaccagcaagagtgagctgcagcaggccttcagtgtcacctccctgacagatctg
tactga

DBGET integrated database retrieval system