KEGG   Rattus norvegicus (rat): 310900Help
Entry
310900            CDS       T01003                                 

Gene name
Mttp, MTP
Definition
(RefSeq) microsomal triglyceride transfer protein
  KO
K14463  microsomal triglyceride transfer protein large subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    310900 (Mttp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vitellogenin_N ArgoN
Motif
Other DBs
NCBI-GeneID: 310900
NCBI-ProteinID: NP_001101197
RGD: 1308388
Ensembl: ENSRNOG00000010655
UniProt: D4A1W8
Position
2q44
AA seq 896 aa AA seqDB search
MILLAVLFLCFFSSYSASVKGHTTGLSLNNERLYKLTYSTEVFLDGGKGKLQDSVGYRIS
SDVDVVLLWRNPDGDDDQLIQVTITAVNVENAGQQRGEKSIFKGKSTPKIVGKDNLEALR
RPMLLHLVRGKVKEFYSYENEPVGIENLKRGLASLFQMQLTSGTTNEVDISGDCKVTYQA
QQDKVVKIKALDTCKIERSGFTTANQVLGVTSKATSVTTYKIEDSFVTAVVAEETRAFAL
NFLQTVAGKIVSKQKLELKTTEAGPRMVPGKQVAGVIKAIDSKYKAIPIVGQVLQSVCKG
CPSLAEHWQSIRKHLEPENLSNAEAVQSFLAFIQHLRTSRREEILQILKAEKKEVLPQLV
DAVTSAQTPASLEAILDFLDFKSDSSIILQERFLYACGFASHPDEELLQALLSKFKGSFA
SNDIRESVMIIIGALVRKLCQNEGCKLKAVVEAKKLILGGLEKPEKKEDTTMYLLALKNA
LLPEGIPLLLKYAEAGEGPVSHLATTVLQRYDASFITDEVKKTLNRIYHQNRKVHEKTVR
TTAAAVILKNNPSYMDVKNILLSIGELPKEMNKYMLTIVQDILHFEMPASKMIRRVLKEM
IVHNYDRFSKSGSSSAYTGYVERSPHAASTYSLDILYSGSGILRRSNLNIFQYIGKAELH
GSQVVIEAQGLEGLIAATPDEGEENLDSYAGMSAILFDVQLRPVTFFNGYSDLMSKMLSA
SGDPVSVVKGLILLIDHSQDIQLQSGLKANMDIQGGLAIDISGSMEFSLWYRESKTRVKN
RVAVVITSDITVDSSFVKAGLESRAETEAGLEFISTVQFSQYPFLVCMQMDKAEAPLRQF
ETKYERLSTGRGYVSRRRKESLVPGCELPLHQENSEMCNVVFPPQPESGNSGGGWF
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcttagctgtgcttttcctctgtttcttctcctcgtattctgcttctgtcaaa
ggtcacacaactggcctctcattaaataatgagcggctatacaagctcacgtactccacc
gaagtgtttctcgatgggggcaaaggaaaactgcaggacagcgtgggctaccggatctca
tcggacgtggacgttgtgttactgtggaggaatcccgacggtgacgatgatcaactgatc
caagtcacgataacggctgtcaatgtcgaaaatgcgggtcagcagagaggagagaagagc
atcttcaagggcaaaagtacacctaagatcgtaggaaaggacaacttggaggctctacgg
agacccatgcttcttcatctggtccgggggaaggtcaaagagttctactcctatgaaaat
gagcccgtgggcatagaaaatctcaagagaggcttggctagcttattccagatgcagtta
acctctggaaccaccaatgaggtagatatctctggggattgtaaagtcacctaccaggct
cagcaagacaaagtggtcaaaattaaggctctggatacatgcaaaattgagaggtccgga
tttacaacagcaaatcaggtgctgggtgtcacttcaaaagccacctctgtcactacctat
aagatagaggacagctttgtcacagcagtggttgcagaagagaccagggcttttgccttg
aacttcctacaaaccgtggcaggaaaaatagtgtcgaagcagaaattggagctgaagaca
acggaagccggcccaagaatggtacctgggaagcaagtggcaggagtaattaaggcaatt
gattccaagtacaaagccattcccattgtgggacaggtcctccagagtgtctgtaaaggc
tgtccttctctggcggagcactggcaatctatcaggaagcacctagaacctgagaacctg
tccaacgccgaggccgtccagagcttcctggccttcattcagcacctccgcacttcgagg
agagaagagatccttcagattctgaaggcagagaagaaagaagttctccctcagctggtg
gacgccgtcacctctgctcagactccagcctcactggaagccatcctggactttttggat
ttcaaaagcgacagcagtatcattctccaggaaaggttcctctatgcatgtggatttgcc
tcccatcctgatgaagaactcctgcaagccctccttagcaagttcaaaggttcctttgca
agcaacgacatcagagagtcggttatgatcatcattggagccctagtcaggaagctgtgt
cagaatgaaggctgcaagctcaaggcagtggttgaagctaagaagctaatcctgggagga
cttgaaaaaccagagaagaaagaggacaccacgatgtacctgctggctctgaagaacgcc
ctgcttcctgaaggcatcccgctccttttgaagtacgctgaggctggggaagggcccgtc
agtcacctggctaccactgttctccagagatacgatgcctccttcatcacagacgaggtg
aagaagaccttgaacaggatataccatcagaatcgtaaggttcatgaaaagactgtacgc
acaacggctgctgctgtcatcttaaagaacaacccctcctacatggatgtgaagaacatt
ctgctgtctattggggaacttcctaaagaaatgaacaaatacatgctcaccatcgtgcaa
gacatcctgcatttcgaaatgcctgcaagcaaaatgatccgtcgggttctcaaggagatg
attgttcacaattatgaccgtttctccaagagtggatcctcttctgcctacactggctac
gtagaacgcagtccccacgcggcgtccacctacagccttgatatcctctactctgggtct
ggcattctgaggagaagtaacctgaacatcttccagtacatcggaaaggcggagctgcat
ggcagccaggtggtcattgaagcccaagggctggaaggcttaattgcagccactccagat
gagggagaggagaaccttgactcgtatgctggtatgtcagccatcctgtttgatgttcag
cttagacctgtcacgttctttaacggatacagtgatttgatgtccaaaatgctgtcggcg
tccggcgaccctgtcagtgtggtgaaaggacttattctgctaatagaccattctcaggat
attcagctgcaatctggactaaaggccaatatggacatccagggtggtctagccattgac
atttctggttcaatggaattcagtctgtggtaccgcgagtctaaaacccgagtgaaaaat
cgggtggctgtggtaataaccagcgacatcacagtggactcgtcttttgtgaaagctggt
ctggaaagcagagcagagacagaggctggcctggagttcatctccacagtgcagttctcc
cagtacccgttcttggtctgcatgcagatggacaaagccgaggctccactcaggcaattt
gagacaaagtatgaaaggctatccacagggaggggctatgtctctcggagaagaaaagag
agcctagtgcccggatgtgaactcccgctccatcaagagaactctgagatgtgcaacgtg
gtattcccgcctcagccagagagcggcaactccggtggtggatggttttga

DBGET integrated database retrieval system