KEGG   Rattus norvegicus (rat): 310914
Entry
310914            CDS       T01003                                 

Gene name
Bmpr1b, CFK-43a
Definition
(RefSeq) bone morphogenetic protein receptor type 1B
  KO
K13578  bone morphogenetic protein receptor type-1B [EC:2.7.11.30]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04360  Axon guidance
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    310914 (Bmpr1b)
   04390 Hippo signaling pathway
    310914 (Bmpr1b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    310914 (Bmpr1b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    310914 (Bmpr1b)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    310914 (Bmpr1b)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    310914 (Bmpr1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    310914 (Bmpr1b)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    310914 (Bmpr1b)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     310914 (Bmpr1b)
Protein kinases [BR:rno01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   310914 (Bmpr1b)
CD molecules [BR:rno04090]
 Proteins
  310914 (Bmpr1b)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 310914
NCBI-ProteinID: NP_001019430
RGD: 1595863
Ensembl: ENSRNOG00000016289
UniProt: Q569A5
Position
2q44
AA seq 297 aa
MVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAAD
IKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKSMLKLAYSSVSGLCHLHTEIFSTQGK
PAIAHRDLKSKNILVKKNGTCCIADLGLAVKFISDTNEVDIPPNTRVGTKRYMPPEVLDE
SLNRTHFQSYIMADMYSFGLILWEIARRCVSGGIVEEYQLPYHDLVPSDPSYEDMREIVC
MKKLRPSFPNRWSSDECLRQMGKLMTECWAHNPASRLTALRVKKTLAKMSESQDIKL
NT seq 894 nt   +upstreamnt  +downstreamnt
atggtgaagcaaattggaaaaggtcgctatggcgaagtgtggatgggaaagtggcgtgga
gaaaaggtagctgtgaaagtgttcttcaccacggaggaagccagctggttccgagagact
gagatatatcagacggtcctgatgaggcacgagaacattctggggttcattgcagcagat
atcaaagggactgggtcttggactcagttatacctcatcacagactatcatgaaaacggg
tctctttatgactatctgaaatccaccaccttagatgccaagtccatgctgaagctagcc
tactcgtctgtcagcggcctgtgccatctacacacggaaatcttcagcactcaaggcaag
ccagccattgcccatcgggacttgaaaagtaaaaacatcctggtgaagaaaaatggaact
tgctgcatagcagacctgggcctggctgtcaagttcattagtgacacaaatgaggttgac
attccacccaacacccgggttggcaccaagcgctatatgcctccagaagtgctggacgag
agcttgaatagaactcatttccagtcctacatcatggctgacatgtacagctttggactc
atcctctgggagattgcaaggagatgtgtttctggaggtatagtggaagaataccagctt
ccatatcacgacctggtgcccagtgacccttcttatgaggacatgagagaaattgtgtgt
atgaagaagttacggccttcattccccaatcgatggagcagtgacgagtgcctcaggcaa
atggggaagcttatgacagagtgctgggcgcataatcctgcctccaggctgacggccctg
agagttaagaaaacacttgccaaaatgtcagagtcccaggacattaaactctga

DBGET integrated database retrieval system