KEGG   Rattus norvegicus (rat): 310958
Entry
310958            CDS       T01003                                 

Gene name
Zzz3, RGD1565468
Definition
(RefSeq) zinc finger, ZZ-type containing 3
  KO
K24536  ZZ-type zinc finger-containing protein 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    310958 (Zzz3)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    ATAC complex
     310958 (Zzz3)
SSDB
Motif
Pfam: Myb_DNA-binding Myb_DNA-bind_6 ZZ
Other DBs
NCBI-GeneID: 310958
NCBI-ProteinID: NP_001128021
RGD: 1565468
Ensembl: ENSRNOG00000050321
UniProt: M0R9X4
Position
2q45
AA seq 909 aa
MVGTCHSMAASRSTRVTRSTVGLNGLDESFCGRTLRNRSIAHPEEISSHSQVRSRSPKKR
PEPVPILKGNNNGRTSDVKQQSAREWVSPRKRRLSSSEKDDLERQALESCERRQAEPALP
VLKNIKRCLRAEATNSSEEDSPVKPDKEPVEIRRTVVDHDAEFQGAKRACRCLILDDCEK
REVKKVNVSEEGPLNAAVLEEITGYLTVNGVDDSDSAVINCDDCQPDRNTKQNSPGSCVL
QEESVAGDGDSETQTSVFCGSGKEDSCIDHFVPCTKSDVQVKLEDHKLVTACLPVERRSQ
LTAESASGPVSEVQSSLRDSEEEVDVVGDSSASKEQCNENSSDPLDTGSECLPASGEPEL
SSMLDCVSAQMTSLSEPQEHRYTLRTSPRRAAQTRGSPTKNTSPYRENGQFEENNLSPNE
TNTTASDNVSESPTNPVEISQDEKVLCCDSENYGSEGLSKPSSEARMNIGHLPSAKESAS
QHTAEEEDDDPDVYYFESDHVALKHNKDYQRLLQTIAVLEAQRSQAVQDLESLGKHQREA
LKNPIGFVEKLQKKADIGLPYPQRVVQLPEIVWDQYTSSLGNFEREFKHRKRHTRRVKLV
FDKVGLPARPKSPLDPKKDGDSLSYSMLPLSDGPEGSHHRPQMIRGRLCDDSKPETFNQL
WTVEEQKKLEQLLLKYPPEEVESRRWQKIADELGNRTAKQVASRVQKYFIKLTKAGIPVP
GRTPNLYIYSRKSSTSRRQHPLNKHLFKPSTFMTSHEPPVYMDEDDERSCPHSHMSTAVE
EASDEESIPVIYRSLPEYKELLQFKKLKKQKLQQMQAESGFVQHVGFKCDNCGVEPIQGV
RWHCQDCPPEMSLDFCDSCSDCPHETDIHKEDHQLEPVYKSETFLDRDYCVSQGTSYSYL
DPNYFPANR
NT seq 2730 nt   +upstreamnt  +downstreamnt
atggtagggacttgccatagtatggctgcttcccgatctactcgtgttacaagatcaaca
gtggggttaaacggcttggatgaatctttttgtggtagaactttaaggaatcgtagcatt
gctcacccagaagaaatctcttctcattctcaagtgcgatcaagatcaccaaagaagaga
ccagagcctgtgccaattctgaaaggaaataataacggaagaacttctgatgtaaaacag
cagagtgctcgagaatgggtaagccctaggaaaagaagactttcttcttcggaaaaggat
gacctagaaaggcaggccctagagagttgtgagagaaggcaggcagagccagcactgcca
gtcttaaagaacattaaacgctgtcttagagctgaagccacaaacagttcagaagaagat
tcgcctgtaaaaccagacaaggagccagtagaaatcaggcggacagtagtggaccatgat
gcagagtttcaaggggctaaacgagcttgtcgatgtcttatattggatgattgtgagaaa
agggaagttaaaaaggtgaatgtcagtgaggaagggccacttaatgctgcagtattagaa
gaaatcacaggctatctgactgtcaatggtgttgacgacagtgactcagctgttataaac
tgtgatgactgtcagcctgacaggaacactaaacaaaatagccctggttcctgtgtgctg
caggaagaatcagtagctggagatggggattcggaaacccagacttcagtgttctgtggt
agtgggaaggaggacagttgtatagaccatttcgtgccttgcacaaagtcagatgtgcag
gtcaagttggaggaccacaaactagtaactgcctgcctgcctgtggaacgtcggagtcag
ctgactgctgagtcagcttcaggccctgtttctgaagttcagtcatccttaagagattct
gaggaagaagtagatgtggtgggagatagcagtgcctccaaagagcagtgtaatgagaac
agcagtgaccctctggacacggggtctgagtgcttgccagcctctggagagcctgaactg
tcctctatgctagactgtgtttcagctcaaatgacatctttgtcagaacctcaagaacat
cgatacaccctgagaacttcacctcgaagggcggcccaaaccagaggtagtcccactaaa
aacacatctccttacagagaaaatggacaatttgaggagaataatctcagtcccaatgag
acaaacacaactgctagtgataatgtaagtgagtctcccacaaatcctgttgagatctct
caagatgaaaaggttctatgttgtgactctgaaaactatggaagtgaaggactaagtaag
ccatcttcagaggccagaatgaatatcggacatttgccatctgccaaagagagtgccagt
cagcacactgcggaagaggaagatgatgaccctgatgtttattactttgaatcagatcat
gtggcactgaaacacaacaaagattatcagagacttctgcagaccattgctgtacttgag
gctcagcgttctcaagcagtgcaagacctggaaagtttaggcaaacaccagagagaagca
ctaaaaaatcctattggatttgtggagaaacttcagaagaaggctgatatagggcttcca
tatccacagagagttgtgcagttgccggagatcgtgtgggaccagtacaccagtagcctt
ggcaactttgaaagggagtttaaacatcgcaaaagacacactaggagagttaagttagtt
tttgataaagtagggttgcctgctagaccaaaaagtcctttagatcctaagaaggatgga
gactccctttcatattccatgttgcctttgagtgatggcccagaaggttcgcatcatcgt
cctcagatgatcagaggtcgtctgtgtgatgacagcaaacctgagaccttcaaccagctg
tggactgttgaagagcagaaaaaacttgaacagctactcctgaagtaccctcctgaagaa
gtagaatctcggcggtggcagaagattgctgatgaactgggcaaccggacagccaaacag
gttgccagtcgtgtacagaagtatttcataaagctaactaaagccggcataccagttcca
ggcagaacacctaacttatatatatactccaggaagtcctcaacgagcaggcgacagcac
ccccttaataagcacctctttaaaccctccactttcatgacttcacatgagccaccagtg
tacatggatgaagatgatgagcggtcctgtccccatagccacatgagcactgctgtcgag
gaggcctcagatgaagaaagcattcctgtcatttataggagtttacctgaatataaagaa
ctattacagtttaaaaagttaaaaaagcagaaacttcaacaaatgcaagcagaaagtggg
tttgtgcaacatgtgggctttaagtgtgataactgcggtgtagaacctatccaaggtgtc
cggtggcactgccaggattgtcctccagaaatgtctttggatttctgtgactcttgttca
gactgcccacatgaaacggatattcacaaggaagatcaccagttagaacctgtttataag
tcggagacgttcttagacagagactactgtgtgtcccagggcaccagttatagttatctt
gaccccaactacttccccgccaacagatga

DBGET integrated database retrieval system