KEGG   Rattus norvegicus (rat): 311030Help
Entry
311030            CDS       T01003                                 

Gene name
Stam2
Definition
(RefSeq) signal transducing adaptor molecule 2
  KO
K04705  signal transducing adaptor molecule
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    311030 (Stam2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    311030 (Stam2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    311030 (Stam2)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    311030 (Stam2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VHS SH3_1 SH3_2 SH3_9 UIM GAT BORCS6 PG_binding_4 ENTH TPR_19
Motif
Other DBs
NCBI-GeneID: 311030
NCBI-ProteinID: NP_001012085
RGD: 1311497
Ensembl: ENSRNOG00000027447
UniProt: Q5XHY7
Position
3q12
AA seq 523 aa AA seqDB search
MPLFTANPFEQDVEKATNEYNTTEDWSLIMDICDRVGSTPNGAKDCLKAIMKRVNHKVPH
VALQALTLLGACVANCGKIFHLEVCSRDFATEVRAVIKNKAHPKVCEKLKSLMVEWSEEF
QKDPQFSLISATIKAMKEEGVTFPSAGSQTVSAAAKNGASLNKNKEDEDIAKAIELSLQE
QKQQYPETKALCPPAESQLSNKVARRVRALYDFEAVEDNELTFKHGEIITVLDDSDANWW
EGENHRGAGLFPSSFVTTDLSTEVEAATVDKSNVIDDDVEEIKKSEPEPVYIDEGKMDRA
LQILQSIDPKDPKPDSQDLLDLEDICQQMGPMIDEKLEEIDRRHSELSELNVKVLEALEL
YNKLVNEAPMYSVYSKLHPAPYSATAAGVPVQTYPVQSHGGNYLGHGIHQVPVAQSYNLG
PDPMGSSRSLPPNMNSVTAHTIQPPYLSTGQDAVSNPSYMTQSSHLQAAAGTAAYTPAMG
VSADLSSFQSTASGLPQLAGFPVAVPVPPAPQPQASYHQQPLL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgttcactgccaacccattcgagcaagatgtggaaaaagccacaaacgagtac
aacaccacagaagactggagtctgatcatggacatctgtgacagggttggaagcactccc
aatggagcaaaggattgcctaaaagctataatgaaaagggtaaaccataaggtccctcat
gttgctctgcaggcattaactcttcttggagcttgtgtggcaaactgtggaaagatattt
catttagaagtatgttcccgtgattttgcaacagaagtacgtgctgtgataaaaaataag
gctcatcctaaagtatgtgaaaaactgaaatctctaatggtagaatggtcagaagaattc
cagaaggacccccaatttagtctgatatctgcaactattaaggctatgaaagaagaagga
gttacttttccttcagcaggttcccagactgtctcggctgctgccaaaaacggggcatca
ctgaacaaaaacaaagaagacgaggacatagctaaagctattgagttatcgttgcaagag
cagaagcagcagtacccggagacgaaggctctgtgtccacccgcagagagccagttgagt
aataaggttgcacggagagttagagctctatacgactttgaggccgttgaggacaacgag
ctcacctttaaacacggcgagattattactgttttggatgacagtgatgccaactggtgg
gaaggagaaaatcacagaggagcaggactcttcccctccagcttcgtaacgactgattta
agcaccgaggttgaggcggcaacagtggacaaatcgaatgtaattgatgacgatgtggag
gaaattaagaagtcggaacctgagcctgtttatatagatgagggtaaaatggaccgagcc
ctgcagattctccagagcatagacccaaaagatccaaaacccgactcccaggacctctta
gacttggaagatatttgccaacagatgggtccaatgatagatgaaaaacttgaagaaatt
gataggaggcactcagagctgtcggagctgaacgtaaaggtgctggaggccctggagctg
tacaacaaattggtcaatgaagcgcccatgtactcagtctattcgaagctccacccggct
ccttactcagccacagcagctggggttccagtgcagacatacccagtccagtcgcatggt
gggaactacctgggtcatggcattcaccaagtacctgttgcccagagctataacctagga
cctgatcctatgggctcatcgaggtctctgcctccaaatatgaactcagtaacagcacac
accatccaacctccatatttaagcactggacaggacgctgtctccaacccttcttacatg
acccagagctctcatcttcaggcagctgctgggacagctgcttacacaccagccatgggg
gtgtctgcagacctgtcctctttccagagcacagcatccggtttgcctcagctggctggc
tttccagtggcagttcctgtacctccagccccacagccacaagcaagttaccaccagcag
ccactcctttag

DBGET integrated database retrieval system