KEGG   Rattus norvegicus (rat): 311071Help
Entry
311071            CDS       T01003                                 

Gene name
Zeb2, Zfhx1b
Definition
(RefSeq) zinc finger E-box binding homeobox 2
  KO
K09299  zinc finger homeobox protein 1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    311071 (Zeb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    311071 (Zeb2)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, AbdB
    311071 (Zeb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-Di19 zf-C2H2_jaz zf-met Homeodomain zf-H2C2_5 zf-C2H2_2 zf-C2H2_6
Motif
Other DBs
NCBI-GeneID: 311071
NCBI-ProteinID: NP_001028873
RGD: 1307272
Ensembl: ENSRNOG00000004677
UniProt: Q3T921
Position
3q12
AA seq 1215 aa AA seqDB search
MKQPIMADGPRCKRRKQANPRRKNVVNYDNVVDAGSETDEEDKLHIAEDDGIANPLDQET
SPASMPNHESSPHMSQGLLPREEEEDEIRESVVEHSWHSGEILQASVDGPEEMKEDYDAL
GPEATIQTTINNGTVKNANCTSDFEEYFAKRKLEERDGHAVSIEEYLQRSDTAIIYPEAP
EELSRLGTPEANGQEENDLPPGTPDAFAQLLTCPYCDRGYKRLTSLKEHIKYRHEKNEEN
FSCPLCSYTFAYRTQLERHMVTHKPGTDQHQMLTQGAGNRKFKCTECGKAFKYKHHLKEH
LRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCIGLISVNGRMRNNIKTGSSPNSVSSS
PTNSAITQLRNKLENGKPLSMSEQTGLLKIKTEPLDFNDYKVLMATHGFSGTSPFMNGGL
GATSPLGVHPSAQSPMQHLGVGLEAPLLGFPTMNSNLSEVQKVLQIVDNTVSRQKMDCKT
EDISKLKGYHMKDPCSQPEEQGVTSPSIPAVGLPVVSHNGATKSIIDYTLEKVNEAKACL
QSLTTDSRRQISNIKKEKLRTLIDLVTDDKMIENHSIPTPFSCQFCKESFPGPIPLHQHE
RYLCKMNEEIKAVLQPHENIVPNKAGVFVDNKALLLSSVLSEKGLTSPINPYKDHMSVLK
AYYAMNMEPNSDELLKISIAVGLPQEFVKEWFEQRKVYQYSSSRSPSLERNSKPLAPNSN
PTTKDSLLPRSPVKPMDSITSPSIAELHNSVTSCDPPLRLTKSSHFTNTKAVDKLDHSRS
NTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMREPKSIIATKNKTKAT
SISLDHNSVSSSSENSDEPLNLTFIKKEFSNSNNLDNKSTNPVFGMNPFSAKPLYTALPP
QSAFPPATFMPPVQTSIPGLRPYPGLDQMSFLPHMAYTYPTGAATFADMQQRRKYQRKQG
FQGELLDGAQDYMSGLDDLTDSDSCLSRKKIKKTESGMYACDLCDKTFQKSSSLLRHKYE
HTGKRPHQCQICKKAFKHKHHLIEHSRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSY
CKREAEEREAAEREAREKGHLEPTELLMNRAYLQSITPQGYSDSEERESMPRDGESEKEH
EKEGEEGYGKLRRRDGDEEEEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKME
TKSDHEEDNMEDGME
NT seq 3648 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagccgatcatggcggatggcccccggtgcaagaggcgcaaacaagccaatccc
aggaggaaaaacgtggtgaactatgacaacgtagtggacgcaggttccgaaacagacgag
gaggacaagctgcacattgctgaggatgacggcattgcaaaccctctggaccaggagacg
agtccagctagcatgcccaaccacgagtcctccccacacatgagccaaggcctgctacca
agagaggaagaagaagacgagataagggagagcgttgtggaacacagctggcacagcggt
gagattctgcaagcctctgtagacggtccagaagaaatgaaggaggattatgatgctctg
gggccagaagccacgatccagaccacaattaacaatggtacagttaagaatgcaaattgc
acatcagactttgaggaatactttgccaaaagaaaactggaggaaagagatggccacgca
gtcagcattgaagagtaccttcagcgaagcgacacggccattatttacccagaagcccct
gaggagctgtctcgccttggcacgccagaggccaatgggcaagaagaaaatgacctgcca
cctggaactccagatgcttttgcccaactgctgacctgcccctactgcgaccgcggctac
aagcgcttgacatcgctgaaggagcacatcaagtaccgccacgagaagaatgaagagaac
ttttcctgccctctttgtagctacacgttcgcctaccgcacccagctcgaaaggcatatg
gtgacgcacaagccagggacagatcagcaccaaatgctaacccaaggagcaggtaaccgc
aagttcaagtgcacagagtgtggcaaggccttcaagtacaagcaccacctgaaagaacac
ctgagaattcacagtggtgaaaaaccttacgaatgccccaactgcaagaaacgcttctct
cattctggttcctacagttcacatatcagcagcaagaaatgtattggtttaatctcagta
aatggccgaatgagaaacaatatcaagacgggttcttcccctaattctgtttcttcttct
cctactaactcagccattactcaactaaggaacaagttggaaaatggaaaaccacttagc
atgtctgagcagacgggcttacttaagattaaaacagaaccactagacttcaatgactat
aaagttcttatggcaacacatgggtttagtggcactagtccctttatgaacggtgggctt
ggagccaccagccctttaggtgtgcacccatctgctcagagtccaatgcagcacttaggt
gtagggttagaagcccctttacttggatttcccactatgaatagtaatctgagtgaggta
caaaaggttctacagattgtggataatacggtttctaggcaaaagatggactgcaagact
gaagacatttcaaagttgaaaggttaccacatgaaggatccatgttctcagccagaagaa
caaggggttacttctcctagtattccagccgtcggtcttccagtagtgagtcataatggt
gccactaaaagtatcattgactataccttagagaaagtcaacgaagccaaagcttgcctc
cagagcttgactactgactcaaggagacagatcagcaatataaagaaagagaagctacgt
actttgatagatttggtcaccgatgataaaatgattgagaaccacagcatacccactccg
ttttcatgccagttctgtaaagaaagcttcccaggtcctatccccctgcatcagcatgaa
cgctacctgtgtaaaatgaatgaagagatcaaggcggtcctgcaacctcacgaaaacata
gtccccaacaaagctggggtgttcgttgacaataaagccctcctcttgtcatctgtactt
tctgagaaaggactgacaagcccgatcaacccgtacaaggaccacatgtctgtactcaaa
gcatactatgctatgaatatggaacccaactctgatgaactgctgaaaatctccattgct
gtgggccttcctcaggagtttgtgaaggaatggtttgagcagagaaaagtctaccagtac
tccagttccaggtcaccatcactggagaggaactccaagcccttagctcccaacagcaac
cccaccacaaaagactctttgttacccaggtctcctgtaaaacctatggactcaatcacg
tcaccatctatagcagaactccacaacagtgtcacgagttgtgatcctcctctcaggcta
acaaaatcttcccacttcaccaatactaaagcagttgataaactggaccactcaaggagt
aacactccttctcctttaaatctttcttccacgtcttctaaaaactcccacagtagctcg
tacactccaaatagcttctcttccgaggagctgcaggctgagccgttggacctgtcatta
ccaaaacaaatgagagagcccaaaagtattatagccacaaagaacaagacgaaagctact
agcataagtttagaccacaacagtgtttcttcatcctctgaaaactcagatgaacctctg
aatttgacttttatcaagaaagagttttcaaattctaataacctggacaataaaagcact
aaccctgtgttcggcatgaacccatttagtgccaagcctttatacacagctcttccacca
cagagcgcatttccccctgccactttcatgccaccagtccagaccagcatccccgggcta
cgaccatacccagggctggatcagatgagcttcctaccacatatggcctatacctaccca
acgggagcagctacctttgctgatatgcagcaaaggaggaaataccagcggaaacaagga
tttcagggagaattgcttgatggagcacaagactacatgtcgggcctagatgacttgaca
gactccgattcctgtctgtctcgaaagaagataaagaagacagaaagtggcatgtatgca
tgtgacttatgtgacaagacattccagaaaagcagttcccttctgcgacataaatacgaa
cacacaggaaagagaccacaccagtgtcagatttgtaagaaagcgttcaaacacaaacac
caccttatcgagcactcgaggctgcactcgggcgagaagccctatcagtgtgacaaatgt
ggcaagcgcttttcacactcgggctcctactcgcagcacatgaatcacaggtactcctac
tgcaagcgggaggcggaggagcgggaagcggccgagcgcgaggcacgagagaaagggcac
ttggaacccaccgagctgctgatgaaccgggcttacttgcagagcatcacccctcagggg
tactctgactcggaggagagggagagcatgccgagggatggcgagagcgagaaggagcac
gagaaggagggcgaggagggctatgggaagctgcggagaagggacggcgacgaggaggaa
gaggaggaagaggaagaaagtgaaaataaaagtatggatacggatcccgagacgatacgg
gatgaggaggagactggggatcactcaatggatgacagttcagaggatgggaaaatggaa
accaaatcagaccacgaggaagacaatatggaagacggcatggaataa

DBGET integrated database retrieval system