KEGG   Rattus norvegicus (rat): 311118Help
Entry
311118            CDS       T01003                                 

Gene name
Tlk1
Definition
(RefSeq) tousled-like kinase 1
  KO
K08864  tousled-like kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    311118 (Tlk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     311118 (Tlk1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  TLK family
   311118 (Tlk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 311118
NCBI-ProteinID: NP_001101204
RGD: 1310370
Ensembl: ENSRNOG00000060572
UniProt: D3ZXW7
Position
3q22
AA seq 516 aa AA seqDB search
MCGVAHILLQIKKCAMDELHSLDPRRQELLEARFTGVATGSTGSTGSCSVGAKASTNNES
SNHSFGSLGSLSDKESETPEKKQSESSRGRKRKAESQNESSQGKSIGGRGHKISDYFEYQ
GGNGSSPVRGIPPAIRSPQNSHSHSTPSSSVRPNSPSPTALAFGDHPVVQPKQLSFKITQ
TDLTMLKLAALESTKNQDLEKKEGRIDDLLRANCDLRRQIDDQQKLLEKYKERLNKCISM
SKKLLIEKSTQEKLSSREKSMQDRLRLGHFTTVRHGASFTEQWTDGFAFQNLVKQQEWVN
QQREDIERQRKLLAKRKPPTANNSQAPATNSEPKQRKNKAVNGAENDPFVRPNLPQLLTL
AEYHEQEEIFKLRLGHLKKEEAEIQAELERLERVRNLHIRELKRINNEDNSQFKDHPTLN
ERYLLLHLLGRGGFSEVYKAFDLYEQRYAAVKIHQLNKSWRDEKKENYHKHACREYRIHK
ELDHPRIVKLYDYFSLDTDTKYPSSRWNGVWRNQNH
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtgtggcacacattcttctccaaataaagaaatgtgcaatggatgaacttcac
agtctggatccaagaaggcaagaattattggaagcgagatttactggagttgctactggg
agcactgggagtactgggagttgcagtgttggagcgaaagcttcaacaaataatgaaagt
tctaatcacagttttggaagcttaggatctctaagtgacaaagaatcagagacaccagag
aagaaacaatctgagtcatccaggggaagaaagagaaaagcagaaagtcagaatgaaagt
agtcagggaaaaagtattggggggcgtggccacaagattagcgactattttgaataccaa
ggtggaaatggctccagtcccgtaagaggcatacctccagcaatccgttctccgcaaaac
tcacactctcattccactccctcctcatctgttcgaccgaatagtccttctcctactgca
ttagctttcggggaccaccctgttgtacaaccaaagcagttatcctttaagatcactcaa
actgatcttacaatgctgaaattggcagcattagaaagtactaaaaatcaggacctggaa
aagaaggaaggtcggatagatgatttgctcagggccaactgtgatctcaggcggcaaata
gatgatcaacagaaattacttgaaaaatacaaagaacgattaaataagtgcatatctatg
agcaagaaactgcttattgaaaagagtacacaagaaaaattgtcaagcagagagaagagt
atgcaagatcggttgcgccttgggcactttacaacagttagacatggcgcttcttttaca
gaacaatggacagatggttttgcatttcaaaatcttgtgaagcaacaagagtgggtgaat
caacaaagggaagatattgaacggcaaagaaaacttctagccaaacgcaaacctcccaca
gctaataattctcaggcacctgcaaccaattctgaaccaaaacaaagaaaaaacaaggca
gtcaacggagcagaaaatgatccctttgttagaccaaatttaccacaactgctgactctg
gcagaatatcatgaacaagaggaaatttttaaacttagactaggacatctcaaaaaggaa
gaggctgaaatccaggcggaactagagcgtttggaaagggtcaggaatcttcacatccga
gagctgaagagaataaacaatgaggataattcacagttcaaagatcatccaacattaaat
gaaagatatttattactccatctgcttggaagaggtggctttagtgaggtgtataaggct
tttgacttgtatgagcaaagatatgctgctgtgaagatccaccagcttaataaaagctgg
agagatgagaaaaaagaaaactaccataaacacgcttgcagagagtatcgaatacacaaa
gagctggaccaccccagaatagttaaactctatgattacttctccttggacacagatacg
aaatatccttctagtagatggaacggcgtgtggagaaatcaaaatcactga

DBGET integrated database retrieval system