KEGG   Rattus norvegicus (rat): 311146
Entry
311146            CDS       T01003                                 

Gene name
Itprid2
Definition
(RefSeq) sperm-specific antigen 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: SSFA2_C KRAP_IP3R_bind YbfN
Other DBs
NCBI-GeneID: 311146
NCBI-ProteinID: NP_001101208
RGD: 1310767
Ensembl: ENSRNOG00000005865
UniProt: D3ZLC3
Position
3
AA seq 1255 aa
MNRPLSAEAEEELEWQVASRRRKAWAKCRSSWQASETEDLSTETTTQDEDEDDEEDLPGA
KLPAAAGRGNVPNEKIAIWLKDCRTPLGASLDEQSSVGPKGVLLRNGGSFEDDLSLGAEA
NHLHEPDAQVENCNNILAKERRLQFHQKGRSMNSTGSGKSSGTVSSVSELLELYEEDPEE
ILYNLGFGRDEPDIASKIPSRFFNSSSFARGIDIKVFLSAQMQRMEVENPNYALTSRFRQ
IEVLTTVANAFSSLYSQVSGTPLQRIGSMSSVTSTKEAADCPPPLTRSNTANRLMKTLSK
LNLCVDKTEKAEGSSTPAAEKGRSLSVSLSEDGGGGKSDPKPQKVIKKKESSSMLATVTE
EVSGSSSTITDSIDADRLSDEAESNISHKVESEENGEAHSQNDALRQSAVTDPDFGHDGG
SMSSLCELESSSELKSAQASSSEKEPCATLTIPSIRNIMVQQKDSFEMEEVQSTEGEAPH
VPATCQLSLAKSKRDHLLRTASQHSDSSGFAEDSTDCLSLNHLQVHESLQAMGSSADSCD
SETTVTSLGEDHVTPTAPDQPYFNESEEESLASLQKGRAKVIVAEKRKADNQDFPHCATA
ENAGNNESVKGPCEPGPQITETETEEEPPLAATGELLREGSGESDMDKGSECEFAQYTTH
HILRSLTSFEEAQGSGMSSKKKTEFPSSVDRVNTALQRAQMKVCSMSGQRVGRSLIKSKD
LLKQRYFLAKAGYPLRRSQSLPTTLLSPVRVVSSVNVRLSPGKETRCSPPSFTYKYTPEE
EQELEKQVTEHDGQSLVKSTIFIPPSSVKKEEAPQSEGTRLEECHHGRLAPCPQFAPISQ
STCSLHSVHSEWQDRPLCEHMRTLSAHSVPNISGAACSAFSSPFGCPYSHRHAAHPCRPC
PVNPPSAIEMQLRRVLHDIRNSLQNLSQYPMTRGPDLAAAPYSTQKSSVLPLYENTFQEL
QVVRRSLNLFRTQMMDLELAMLRQQTVVYPHMTEEDRYEVDQLQGLRNSVRMELQDLELQ
LEERLLGLDEQLRAVRVPSPFRSSALPGMCGSRSADNLSCPSPLNVMEPVTELMREQSYL
KSELGLSLGDMGYEIPPGESSESVFSQATSESSSVCSSPSHTNRRSRGPSGSKPRARLVA
RKKIFRASVALTPTAPSRTGSVQTPPDLESSEEAGAAEEASQVVGLTSHVEEEPEDLSLM
PTAEEMHRNVEQDELQQVIREIKESIVGEIRREIVSGLLAAVSSSKASASKQDSH
NT seq 3768 nt   +upstreamnt  +downstreamnt
atgaaccgacccttgtcggcggaggcggaggaggaactggagtggcaagtggcgagtcgc
aggaggaaggcctgggccaagtgccgcagctcctggcaggcgtcggagaccgaggatctg
tccacagagacgacgacacaggacgaggacgaggacgacgaggaggacctcccaggcgcg
aagctgccggcagccgcggggcgaggaaacgtgcccaacgagaagatcgcgatatggctc
aaagactgccgcactcctttgggagcctcactggatgagcaaagcagcgttgggcccaag
ggtgtgcttttgagaaatggaggaagctttgaagatgacttgtcactgggagctgaagcc
aatcacctacatgaacctgatgctcaagttgaaaactgcaacaatatcttggccaaagag
agaagacttcagtttcatcagaaagggagaagtatgaattccactgggtctgggaaaagc
agtggtactgtgtcaagtgtttcagaactgctggagctttacgaggaagatcctgaagaa
attctatataatcttggatttggacgagatgaaccagatattgcttctaaaattccttcc
agattttttaattcgtcatcctttgccagaggcatagacattaaagtgtttttgagtgcg
caaatgcagcggatggaagtggagaacccaaattacgctctgacaagccgttttcgtcaa
attgaagtcctcactactgtggccaatgcattttcttctctgtattcccaagtctctgga
accccattgcagaggattggaagtatgtcctcagtgacctccaccaaggaggcggcagac
tgccctcctcccctgactcgaagcaacactgcaaaccgtctgatgaaaacactctcaaaa
ctaaacttgtgtgttgataaaacagagaaagcagaagggagctctacccccgctgctgag
aaaggaaggagtctaagtgtttcactgtctgaagatggtggaggcggcaagagtgaccca
aagcctcagaaggttataaagaagaaggagtcctcttcaatgctggctacggttacagaa
gaagtctcaggcagttcctcgaccatcacagacagcattgatgctgacaggctttctgat
gaagcagagagtaacattagccacaaggtggaaagtgaagaaaatggagaagctcacagt
cagaatgacgcgctccggcagtctgctgttacagatcctgactttggccatgacgggggc
agcatgtccagcctctgtgagctggagagcagcagtgagctgaagagtgcccaggcgtcc
tcgagtgagaaagagccatgtgcaaccctgacaatcccatccataagaaacataatggtg
cagcagaaagactcctttgagatggaagaggtccagagcacagagggagaagcacctcac
gtgccagccacttgccagctaagccttgccaagtcaaaaagagatcatctgttgcgaact
gcaagtcagcattctgatagcagcgggtttgctgaggattccacagactgcctctccctc
aatcaccttcaggttcatgagtccctgcaagccatggggagcagtgctgacagctgcgac
agtgaaacaactgtcacatcacttggtgaagaccatgtgactccgacagcaccagaccag
ccttacttcaatgaatcagaggaggagtctcttgcctctctgcagaagggaagagcaaag
gtcatagttgctgagaaaagaaaagcagataaccaagatttcccccactgtgcgactgca
gagaatgctggaaacaatgagtccgtgaagggtccatgtgagcctgggcctcagattaca
gagactgagacagaggaggagccacctctggcagccactggagagctcctgagggaaggg
agtggagagagtgatatggataagggcagtgaatgtgaatttgcgcagtacaccacacac
cacattctcaggtccttgacttcctttgaagaggctcagggcagcggtatgagctctaaa
aagaaaactgagtttccctcttctgtggacagagtgaacactgccctgcagagagctcaa
atgaaggtttgcagtatgtctggtcagagagtagggcgtagcctaataaaatcaaaggat
ctgttgaaacaaaggtactttctcgcaaaagctggctatcctctaagaaggtctcagtct
ttgcccaccactttactgagcccagtaagggtggtatcttctgtcaatgtacgattatct
ccaggaaaagagaccaggtgcagcccaccatccttcacctacaagtacacacctgaagag
gaacaagaattggaaaagcaagtaactgaacacgatggccagtctttggttaaatctacc
atcttcatccctccatcctctgtgaagaaagaagaggcccctcagagtgaggggacacga
ctggaggaatgccaccatggaaggcttgccccctgcccacagtttgctccaatctcccag
tccacctgctcccttcactctgtccactctgagtggcaggacaggcctctgtgtgaacac
atgagaactctgagtgcccatagtgtccccaacatatcaggtgctgcatgtagtgccttc
tcctctccttttggttgtccctactcacatagacacgctgcccacccatgcaggccatgc
cctgtgaaccctccttccgccatagagatgcagttgcggagagtgttacatgacattaga
aactcactacagaatctctcacagtaccctatgacgagaggacctgatcttgctgctgct
ccatacagtactcagaagtcgtctgttctacctctttatgaaaatacctttcaggagctt
caggttgtgagacggagcctgaatctgttcagaacgcagatgatggacttggagctggcc
atgctgcgtcagcaaacggtggtgtaccctcatatgacagaggaggacaggtatgaagtt
gatcagctgcagggcctgcggaactctgtccgaatggagctgcaggacctggagctgcag
ctggaggagcgcttgctgggcctggatgagcagctccgtgcagtgcgggtgccttcacca
ttccgttcctctgcactcccggggatgtgtggcagtaggagcgctgataacttatcatgc
ccgtctccactgaacgtcatggagccggtcacagaactgatgcgagagcagtcgtacctg
aagtctgagctgggcctgagccttggagacatggggtatgagattcctcctggagagagc
tcagagtccgttttctctcaagctacatcagagtcatcttccgtctgctccagcccctcc
cacaccaacagaagatctagagggccatccgggagcaaacccagagcccgcttagtggcg
agaaagaagatattccgagcctctgtggccctgacaccaactgccccgtctagaacaggc
tctgtgcaaacacctccagatctggagagttctgaagaagctggagcagctgaagaagcc
tcacaagtcgtgggacttacatctcacgtggaggaagaaccagaggatctctctctgatg
ccaacggctgaggaaatgcaccggaatgtggagcaggacgagctgcagcaggtcatccgc
gagattaaagagtctattgttggggaaattagacgagaaattgtaagtggacttttggca
gcagtgtcttcaagtaaagcatctgcttctaagcaggacagccactga

DBGET integrated database retrieval system