KEGG   Rattus norvegicus (rat): 311163
Entry
311163            CDS       T01003                                 

Gene name
Ctnnd1
Definition
(RefSeq) catenin delta-1
  KO
K05690  catenin (cadherin-associated protein), delta 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04520  Adherens junction
rno04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    311163 (Ctnnd1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    311163 (Ctnnd1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    311163 (Ctnnd1)
SSDB
Motif
Pfam: Arm HEAT_2 Cnd1 Atx10homo_assoc Ebp2 HYPK_UBA
Other DBs
NCBI-GeneID: 311163
NCBI-ProteinID: NP_001101210
RGD: 1305643
Ensembl: ENSRNOG00000030790
UniProt: D3ZZZ9
Position
3
AA seq 932 aa
MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANSLMANGTL
TRRHQNGRFVGDADLERQKFSDLKLNGPQDHNHLLYSTIPRMQEPGQIVETYTEEDPEGA
MSVVSVETSDDGTTRRTETTVKKVVKTMTTRTVQPVPMGPDGLPVDASAVSNNYIQTLGR
DFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYGRHYEDGYPGGSDNYGSLSRVTRIEER
YRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYGLEDDQRSMGYDDLDYGMMS
DYGTARRTGTPSDPRRRLRSYEDMIGEEVPPDQYYWAPLAQHERGSLASLDSLRKGMPPP
PNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPILVGLLDHP
KKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLS
SHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSE
RSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERY
QEALPSVANSTGPHAASCFGAKKGKGKKPTEDPANDTVDFPKRTSPARGYELLFQPEVVR
IYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTSEHERV
VKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVVSILNTINEVI
AENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKK
SDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIPMSNMGSNTKSLDNNYST
LNERGDHNRTLDRSGDLGDMEPLKGAPLMQKI
NT seq 2799 nt   +upstreamnt  +downstreamnt
atggacgactcagaggtggagtcgaccgccagcatcttggcctctgtgaaagaacaagag
gcacaatttgagaagctgacccgggcgctggaggaggagcggcgccatgtgtcggcgcaa
ctggaacgcgtccgggtctcaccacaagatgccaactcactcatggccaacggcaccctc
acccgtcggcatcagaacggccggtttgtgggcgatgctgaccttgagagacagaaattt
tcagatttgaaactcaacggaccccaggatcacaaccaccttctgtatagcactatcccc
aggatgcaggagccaggtcagatcgtggaaacctacacagaggaggaccctgaaggagcc
atgtctgttgtttctgtggagacctcagatgatgggaccactaggcgcacagagaccaca
gtcaagaaagttgtgaagacgatgacaacgcggacagtgcagcctgtccccatggggcca
gatgggctgcctgtggatgcctcagcagtctccaataactatatccagaccttgggccgt
gatttccgcaagaatggcaatgggggccctggtccctatgtggggcaggcgggcactgca
actcttcctaggaacttccactatcctccagatgggtatggccgacactatgaagatggt
tatccaggtggcagtgacaactatggcagtctgtcccgagtgacccgaattgaggagcgg
tataggcccagcatggagggctaccgggcacccagtagacaagatgtctatgggccccag
ccccaggttcgagtaggtgggagcagtgtagatctgcatcgttttcatccagagccttat
gggctagaggatgaccagcgcagcatgggctatgatgacctagattacggcatgatgtct
gattatggtactgcccgtcggacaggaacaccctcggaccctcgacgacgcctcaggagc
tatgaagacatgattggtgaagaggtgccacctgatcagtactattgggctcctttagct
cagcacgagcggggaagtttagcaagcttggatagtctgcgcaagggaatgcccccgcct
ccaaactggagacagcctgagctgccagaggtgattgccatgctaggcttccgcttggat
gctgttaagtccaatgcagctgcatacctgcagcacttatgctaccgcaatgacaaggtg
aagactgatgtgcggaagctcaagggcatcccgatattggtaggattgttagaccatccc
aaaaaggaagtgcacctcggagcctgtggagctctcaagaatatctcttttggacgtgac
caagataacaagattgccataaaaaactgtgatggtgttcctgccctggtcagattgctc
cgaaaggctcgtgatatggacctgactgaagtgattactggaaccctgtggaatctctca
tcccatgattcaatcaaaatggagattgtggaccatgcgctacacgccttgacagatgaa
gttatcattccgcattctggttgggagagagaacctaatgaagactgtaagccacggcat
attgaatgggagtcagtgctcaccaacacagctggctgccttagaaatgtaagctcggag
aggagtgaagcccggcggaaacttcgggagtgtgatggcctagttgatgccctcattttc
attgttcaggcagaaattgggcagaaggattcagacagtaaacttgtggagaattgtgtt
tgcctccttcggaacttatcatatcaagttcatcgtgaaatcccacaggcagagcgttac
caggaggcacttcctagtgtggctaacagtactgggccacatgctgccagttgctttggg
gccaagaagggcaaagggaaaaagcctaccgaggatccagcaaatgatacagtggatttc
cctaaaagaactagtcctgctcggggctatgaactcttatttcagccagaagtggtgcga
atatacatttcactccttaaggagagcaagacacctgccatcctagaagcctcggctgga
gctatccagaacttgtgtgctgggcgctggacatatggcagatacatccgctctgctctt
cgtcaagagaaggctctctctgccatagctgacctcctgaccagtgaacacgagcgagta
gtgaaagctgcctctggggcactgagaaatctggctgtggatgctcggaacaaagagtta
attggcaaacatgctattcctaacttggtaaagaatctgccaggaggtcaacagaactcc
tcctggaatttctctgaagacaccgtggtctctatattgaacaccatcaacgaagttatt
gctgagaacttggaagccgccaaaaagcttcgagagacccagggtattgagaagctggtg
ttgatcaacaaatcagggaatcgctcagaaaaagaagtccgggcagcagctcttgtcctg
cagacaatctggggctataaggagcttcggaagccactggaaaaagaggggtggaagaaa
tcagacttccaggtgaatctaaacaatgcatctagaagccagagcagccattcatatgat
gatagcactctccccctcattgaccggaaccaaaaatcagataagaaacctgaccgggaa
gaaattccaatgagcaatatggggtcaaacacaaaatcattagataacaactattccaca
ctgaatgagagaggagaccacaacagaacactggaccgatctggggatttgggtgatatg
gagccattgaagggagcacccttgatgcagaagatttag

DBGET integrated database retrieval system