KEGG   Rattus norvegicus (rat): 311184Help
Entry
311184            CDS       T01003                                 

Gene name
C1qtnf4
Definition
(RefSeq) C1q and tumor necrosis factor related protein 4
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: C1q BclA_C
Motif
Other DBs
NCBI-GeneID: 311184
NCBI-ProteinID: NP_001101215
RGD: 1311006
UniProt: B5DF52
Position
3q24
AA seq 326 aa AA seqDB search
MLLLLLGFLGPVACWALGRAGPGSSELRSAFSAARTTPLEGTSEMAVTFDKVYVNIGGDF
DAATGRFRCRVPGAYFFSFTAGKAPHKSLSVMLVRNRDEVQALAFDEQRRPGARRAASQS
AMLQLDYGDTVWLRLHGAPQYALGAPGATFSGYLVYADADADAPARGPAALEPRSAFSAA
RTRSLVGSDAGPGPRHRPLAFDTELVNIGGDFDAAAGVFRCRLPGAYFFSFTLGKLPRKT
LSVKLMKNRDEVQAMIYDDGASRRREMQSQSVMLPLQRGDAVWLLSHDHDGYGAYSNHGK
YITFSGFLVYPDLTAASPPALKPPEL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcctcctgctcggcttcctaggcccggtggcctgctgggcactgggccgggct
gggcctggctcctcggagctgcggtcagccttctcggcggctcgcaccaccccactggag
ggcacgtcggagatggcggtgaccttcgacaaggtatacgtgaacatcggaggtgacttc
gacgcagccaccgggaggttccgctgtcgcgtgcccggcgcctatttcttctccttcaca
gcgggcaaggccccgcataagagcctgtcggtgatgctggtgcgcaaccgcgacgaggtg
caggcgctggccttcgacgagcagcggcggccgggcgcacggcgcgccgccagccagagt
gccatgctgcagctcgactacggcgacacggtgtggctgcggctgcacggcgccccgcag
tacgcgctcggcgcgcccggcgccacctttagcggctacctggtgtacgcggacgccgat
gctgacgcgcctgcgcgcggccccgcagccctggagccgcgctcggccttctccgcggcg
cgcacgcgcagcctggtgggctcggacgcgggacccggaccgcgccaccggccgctggcc
ttcgacaccgagctggtaaacataggcggcgacttcgacgcggcggccggcgtgttccgc
tgccgcctaccgggagcctatttcttctccttcacgctgggcaagctgccgcgcaagacg
ctgtcggtgaagctgatgaagaaccgcgacgaggtgcaggccatgatttacgacgatggc
gcttcgaggcgccgtgagatgcagagtcagagcgtgatgctgccactgcagcgtggcgat
gccgtctggctgcttagccacgatcatgatggctatggcgcctacagcaaccacggcaag
tacatcactttctctggcttcctggtgtaccctgacctcactgctgcctccccgccggcc
ctcaagcccccagagctctga

DBGET integrated database retrieval system