KEGG   Rattus norvegicus (rat): 311254Help
Entry
311254            CDS       T01003                                 

Gene name
Pdhx, Ac1164
Definition
(RefSeq) pyruvate dehydrogenase complex, component X
  KO
K13997  dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01100  Metabolic pathways
Module
rno_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    311254 (Pdhx)
   00020 Citrate cycle (TCA cycle)
    311254 (Pdhx)
   00620 Pyruvate metabolism
    311254 (Pdhx)
  09112 Not included in regular maps
   09113 Global maps only
    311254 (Pdhx)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding
Motif
Other DBs
NCBI-GeneID: 311254
NCBI-ProteinID: NP_001037707
RGD: 1566332
Ensembl: ENSRNOG00000006947
UniProt: Q7TQ85
Position
3q32
AA seq 539 aa AA seqDB search
MQVEEGAKNIKLGSLIALMVEEGEDWKHVEIPKDVSAPPPVPKPPAPPQPSPQTQTPCPA
RKERTVGTPPRLRLSPAARNILEKHSLDASQGTATGPRGVFTKEYELSPIKVQQRLVRWA
VTCVKSSQQCVTPVLVRLTVVLEVLGSQSAGGWCDSRSDQRTTARATVSLEKSTGSELVF
RFHVKTEVVLQVHVVQKHSHEDALRLVELKQMGKIAEFRPAPGPPSTLSAPVPPQPTAGL
SYPRPMIPPVSIPGQPNAAGTFTEIPASNIRKVIAKRLTESKSTVPHAYATANCDLGAVL
KVRRDLVKDDIKVSVNDFIIRAAAVTLKQMPGVNVTWDGEGPKHLPSVDISVAVATDKGL
ITPIIKDAAAKDIREIADAVKPHLLYFLFWPCVTVEALQLRIIEQWFGNSYDIYMCAGRH
VLWPLSSIAEGSVLKYANLIGTMPPSAVFSPLSSISNLGMFGIDEFTAVINPPQACILAV
GRFRPVLKLTEDEEGNPQVRQHQLITVTMSSDSRMVDDELATKFLETFKANLENPMRLA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttgaagaaggtgctaaaaatataaagctgggttcgctcattgctttgatggtt
gaagaaggagaagactggaaacacgtggaaattcccaaggatgtcagcgctccacctcca
gttccaaagccaccagcgcctcctcagccctctccacagacgcagactccttgccctgcc
aggaaggagcgcacagtagggacaccaccacggctccgcttaagtccagctgcccgcaac
attctggaaaaacattcattggacgccagccagggcacagccacaggccctcgaggggtc
ttcactaaagagtatgaacttagcccaataaaggtacaacagagactggtccgatgggct
gtgacctgtgtgaaatcctcacagcagtgtgtgactccagtactggttagattgacggtg
gtgctggaagttttaggatctcagagtgcaggtggctggtgtgacagccgttctgatcaa
agaacaacagcccgagccactgtgtctctggagaagagcacaggctcagagctggtgttc
agatttcacgttaagacagaggtagtgctccaggtgcatgttgtacagaagcacagtcat
gaagatgcactcaggttagtcgagctgaaacagatgggcaagattgccgaattcagacca
gccccaggtcctccaagcactctctcagcacctgtgcctcctcagcccacagctgggctg
tcgtaccctcggccaatgatcccaccagtctctatccctgggcagcctaatgcagcgggt
acattcactgaaattcctgccagcaatattcgaaaagttattgctaagaggttaactgaa
tcaaaaagtactgtgcctcacgcctatgctactgctaactgtgaccttggagcagtttta
aaggttagacgagatctggtcaaagatgacattaaagtctcagttaatgactttatcatc
agagcagcagctgttactcttaagcaaatgcctggggttaatgtcacctgggatggagaa
ggcccaaagcatctgccctctgttgacatttcagtggctgtggcaacagataaaggttta
attacaccaatcataaaagatgcagctgctaaggacatacgggagatcgctgacgctgta
aagccacacctcttatatttcctcttctggccgtgtgtcactgttgaggccctccagttg
aggattatcgaacagtggttcggtaatagttatgatatttatatgtgtgctggtagacat
gttctttggcccttgagcagcatagcagaaggttcagtactaaaatacgcaaacctaatt
gggaccatgccgccttcagcagtgttttctcccctctccagtatttccaacttgggcatg
tttggcatcgatgagttcactgcagtgattaacccgcctcaggcctgtatcttggcagtt
ggaagattccgtccagtgctgaaactcactgaggatgaagaggggaacccccaagtgcgg
cagcaccagcttataactgtcacgatgtcaagtgacagccgaatggttgatgatgaacta
gctaccaagtttcttgaaactttcaaagcaaacttagagaaccccatgcgacttgcatag

DBGET integrated database retrieval system