KEGG   Rattus norvegicus (rat): 311336Help
Entry
311336            CDS       T01003                                 

Gene name
Nusap1
Definition
(RefSeq) nucleolar and spindle associated protein 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: NUSAP
Motif
Other DBs
NCBI-GeneID: 311336
NCBI-ProteinID: NP_001101232
RGD: 1305764
Ensembl: ENSRNOG00000004921
UniProt: D4AAK2
Position
3q35
AA seq 376 aa AA seqDB search
MTVPSAEELDSFKYSDLQNLAKRLGLRANLRADKLLRALKAHLNPETRRENKNQDENQSS
AFSYDETETQVTSEEQAETESGSHVTRTRRRKRKTIHGIPTSQDHMEMKRRDSTTFQNQE
NQDLRATEKVPSLPEQRPEDGNAASSEEGKINDKKGPLEKRSLCTDGFSKLGNSKRISAT
TPNFKRLHEAHFKKMESIDEYMVRKKKHFKEHDSLNELKLDKKVTPVPPRGRLSVLCTPA
RQRCSQGHSATKMNVRFSAATKDNEHKCSLTKTPARKSPHVTAPGSASKGQAVLKTPKLK
TTERNSTAGKLKPWGQAKENNSLNECVSRVTLHRKTYKQPPLQTREEQRKRHVQERKERK
EKLLEARRNLGVTKAQ
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcccctctgcagaggagctggactccttcaagtacagcgacctgcaaaattta
gccaaaagactgggcctccgggctaacctgagggcagacaagttgttaagagccttgaaa
gcacacctgaatccagaaacaagaagagaaaataaaaatcaggatgaaaatcagtcttct
gcattctcctacgatgagactgagacacaagtcaccagtgaggagcaggctgagacggaa
tcaggtagtcatgtcaccagaaccaggaggaggaagcgcaagaccatccatggaattcct
acctcccaggatcatatggagatgaaaagaagagacagcactacattccaaaatcaggaa
aatcaagacctcagagctactgaaaaggttccttctctgccagagcaaaggccagaagat
gggaatgcagcttcctcagaagaaggaaaaataaacgacaaaaaggggcctttggaaaaa
agatctctgtgcacggatgggttttctaaacttgggaatagtaaaagaatttcagccact
acaccaaactttaagaggcttcatgaggctcattttaagaaaatggaatccattgatgaa
tatatggtgagaaaaaagaaacactttaaagagcacgattcacttaatgaactaaagctt
gacaaaaaagtgaccccagttccaccaagagggagactctctgtactctgcactcctgcg
aggcagcggtgctcacagggccactcagcaactaaaatgaatgtcaggttctcagctgct
actaaagataatgaacataagtgctcgctgaccaagacaccagccagaaagtccccacat
gtgactgcacctgggagtgcttcaaagggccaggctgtgctcaagacaccaaagttaaag
accactgagaggaattccactgcaggaaagctgaaaccttggggccaagctaaagagaat
aattctctgaatgaatgtgtgagcagagttaccctgcacaggaaaacttacaaacaacct
cctctccagaccagggaagaacaacggaagagacatgtgcaagaacggaaggagagaaaa
gaaaagcttttggaagctcgaagaaacttgggtgtgactaaagcccagtga

DBGET integrated database retrieval system