KEGG   Rattus norvegicus (rat): 311372Help
Entry
311372            CDS       T01003                                 

Gene name
Spg11, RGD1562529
Definition
(RefSeq) spastic paraplegia 11 (autosomal recessive)
  KO
K19026  spatacsin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    311372 (Spg11)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     311372 (Spg11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spatacsin_C
Motif
Other DBs
NCBI-GeneID: 311372
NCBI-ProteinID: NP_001178500
RGD: 1562529
Ensembl: ENSRNOG00000021954
UniProt: D3Z9Z3
Position
3q35
AA seq 2315 aa AA seqDB search
MAAKPGPGSAASPGCAGAMERVLPMLLVRIPAEETAQLGPRAQLHRELEALGSLTAAGSL
QVLSLAPGSRGGSSCRLQGPFRQFLWEESQNSTSADKPRVLVAREDCGLLIYEFDLRDGR
CDAALLHSCCGRTLQKLTEDQGVSISFKSLRILSFDNSTSLLLINECLVVRVVFPGRESG
IGVLGCLSLPLPAQAVDTIIDVQLCKRFLFLLSTLGWIHIFDTVKGMHVARVDLALPRED
SEQQEPASISSFMSLKVSRDLDVLLLVSSSSTAVALNLHLYFRLHPGHLLCEGTLQDLPI
EGPTGIDEDDLVNSAHNMKLTKVSFQVDRSWRAQLASLNESVRSSEPELSCYPPWFQGAL
CLESLESGNHSPIVPNHVFIPGDVPSGQYAFPQKEHSKTSEPRPWRTMHLSEQEQPTELT
CLSVTGFTALFIQAVGTTSCTVVLWDLETQSMQCFSLSQKCTPVDISGDQQLCLALTENG
LSLILFGLTQEEFLNRLMIHGSASTVDSLCHLNGWGRCSIPIHALEAGIENRQLDTVDFF
LKSKENLLTPSSKSPAPDQQQHFSSQLYLRQVEEMTPALDLLCSAIRESDSETQSKHFAE
QLLHLTLSFLNKQMRELFDHTEELDEHLQKGAAILTSYINELRTFMIKFPWKPGDAIDES
DENEEVLTVKEGQVWEELRSEEVIADAILNNRIPEAQTFFRITGHSAQRLEELVRIGLDL
AFDSLKKNSVEEASRLLRNMGFSVEDELLKISFYTTDKNIRDFLVEILKEKECFSEKERR
TVDFVHQAERLYSGHFQENAPMQAFPRYWIKEQDCFKHKSVLDTFLKCDTKDEFTKQDHR
IALNWAHWWDRQTQECILLPRISSEEYKAHSPEALWRHLTARHDWSSISLWMEEFQAQET
VSPQQSKWPPLSAAVIEQNTCCSRHMRNAILDQLARCGIFLASELEDFELLLLRLSRIGG
VMQDALPVQSYRSSAGCNFDSQVILYCLEHGLQHLLYVYLDYYKLSPGNCPFLEKKELHE
AHPWLEFLVQCRQVSSNLTDPKLIFQASLANAQISIPTNQASVSSMLLEGHTLLALATTM
YAPGGVSQVIQHEDSENCLKKVDPQLLKMALTPYPKLKAALFPQCTAPSILPSDITLYHL
IQSLPPFDPSRLFGWQSANTLAIGDAAGQLPHFSSPDLVSKYAVVEQLSYTYYLHHGRPS
FAFGTFLVQELIKSKTPKQLIQQVGKEAYTLGLSSFHNPSVGAACVCFLELLGLSSLKLR
VDLKMANVVLGSRRRNEDAHPSFIRESLAEKLSKLADGDRATTEELLVLLEEGVWDSIEQ
QGFNRLSSESSSQWSLVLQFCMLHDMKLSVSYLRECAKANDWLQFLVHSQLHNYHPEEVE
TLLQYFSPVLQSHLKLASEKLSSGSISKDDSCLQELQKNKETSDFFEILHRCSDESASWC
WLLAEAVRHRVPILSVLASCIQGASAVPCLCVWIVTSVEDKVAAEAIEHIQISVEDHHWS
LEDLSIIWRTVLTRRKIHTLIRGFRLFIKDSPLLLIMEMYELCVFFKNYGKAKVKLVEFQ
KSLEMLDTVATRVLPVIPATWMREQVCFLLKLMPQQCETQYELQKVLQLFVGMEQLFSDG
PDVQKLYRLSQVLKDTPITISPAVISSYSTESLQRECRSILEKLKADGQFAVARRVAELA
SLPVDGLVIEQLTQEMQMLTHTQQWSLKQARLDFWRKCHENFKKNSVSNRAASSFFSSQA
PEASEHPAEQGSLEERHLLLTLAGHWLAQEEPVPVEELEELEKQIWLCRIAQHTCGGAEE
ETKPSLSQHKLAPAELSSDSSASEFSFSKLAALNTSKYLDLNGLPSKEMCENTLEHREQE
SLNTLIGQLLDGGCVHEASRVCRYFRVYSQDLVLLLHCRALASAEASMEDLHSEIRALLS
NATLPEDLESPGVPLRKVHSREKQPFNLAEESQTFLQLTALCQDRTLVGMKLLDKIPSVP
HGELSCTTELLILAHHCFTCACYMEGIIRVLQAARMLTDNHLAPNEEYGLVVRLLTGIGR
YNEMTYIFDLLHQKHYFEVLMRKKLDPTGTLKTALLDYIKRCHPGDSEKHNMIALCFSMC
REIGENHEAAACIQLKLIESQPWEESLKDGAQLKQLLLKALTLMLDAAESYAKDSCVRQA
LHCNRLTKLITLQIHFLNSGQNTMLINLGHQKLMDCIMTLPRFYQASIVAEAYDFVPDWA
EVLYQQVILKGDFSYLEEFKQQKLLKPNIFEDISKKYKQHQPTDRVTENLKKLLSYCEDI
YLYYKLAYEHKFFEIVNMLLKDPQTGCCLKDMLAG
NT seq 6948 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaagccagggcccggaagtgctgcctcccccggctgtgccggcgccatggag
cgagttctacccatgctgctggtgcggatccctgccgaggagacggcgcagctgggaccg
cgggcgcagctgcaccgagagctggaggccctggggagcctgacggctgcgggcagtctc
caagtgctttccttggcgccgggcagtaggggtggaagcagctgccgcctccaaggcccc
tttaggcagttcctgtgggaggagtctcagaacagcacatcagcagacaagcccagagtg
cttgttgctcgagaagattgtgggctgctcatatatgaatttgacttgagagatggaaga
tgtgacgcagccttactacacagctgttgtgggaggaccctgcagaagctcactgaagat
caaggtgtcagcatttccttcaagtctttgaggattctgtcatttgacaacagcacgtcc
ttactgctcatcaatgagtgtctcgtcgtacgtgtcgtgtttccggggagagaatctggg
attggagtgctgggctgcctctcactgcccttgcctgcacaggcagtggacacgataatt
gacgtgcagctctgcaagaggtttcttttccttctgagtacattaggctggatccatatt
tttgacactgtaaagggcatgcatgtagcccgcgtggacttggctcttccccgagaagat
tctgagcagcaggagcctgccagcatttcttcctttatgtcactgaaagtgtctcgggac
ttagatgttttgctactcgtcagctcgtccagtactgcagttgctcttaaccttcacttg
tatttcaggctacacccagggcacctgctgtgtgaaggaactctgcaagacctccctatt
gaagggcctacaggaatagatgaagatgaccttgttaattctgcccacaacatgaaactg
accaaggtgtccttccaagttgataggtcctggagagcccagctggcatcactgaatgaa
tctgtgaggagctcagaaccagagctttcctgctatcctccgtggttccagggtgctttg
tgtttggagtccctggaatctggtaaccactcccccattgtgccaaaccacgttttcatt
ccaggggatgtcccgagtggccagtatgcttttcctcagaaggagcacagcaagaccagt
gagccaaggccgtggaggacaatgcacctgagtgaacaagagcagcccacagagctcacg
tgtctgtctgtgacgggatttacggccctgtttattcaggcagtaggaacgaccagctgc
accgtcgtcctctgggacttggagacccagagcatgcagtgtttttctctcagccagaag
tgtactcctgtagacatcagcggagaccagcagctgtgccttgctttgacagagaacggc
ctgtctctgattttgtttggtttaactcaagaggagtttctgaacagactgatgatccat
ggcagtgccagcactgtggactccctttgtcatctcaacggttggggacggtgctcaatc
cccatccacgctctagaggctggcatagaaaatcgtcagctggacacggtagatttcttc
ctgaagagcaaggaaaatcttcttactccatcttcaaaatctcctgcccctgatcagcag
cagcacttctcctcccagctctacctaaggcaggtggaagagatgaccccagccctggac
ttactctgctcagcaattagagaaagcgactccgaaacccaaagcaagcactttgcagag
cagctgcttcacctcacactgtctttccttaacaagcaaatgagggagctttttgatcac
actgaagagctagatgagcatttacagaaaggagcagccattttgaccagctacatcaat
gaacttcggacttttatgataaagtttccttggaagccaggagatgccatagatgaatct
gatgaaaatgaagaggtcctcacagtgaaagaaggccaggtttgggaggaactccgctct
gaggaagttattgctgatgccattttaaataacagaataccagaggcacaaactttcttc
aggattactggtcattccgctcaacgacttgaggaactggttaggataggcctagatttg
gcatttgacagtttaaaaaagaacagcgtggaggaggcctccaggctcttgaggaacatg
ggcttcagtgtggaagacgagctgcttaagataagcttttatacgactgataaaaacata
cgggactttttggttgaaattttaaaagaaaaggaatgtttttctgaaaaagaaagaaga
actgtggactttgtccatcaagctgaaaggctttactcaggacacttccaggaaaatgcg
ccgatgcaggcttttcccaggtattggataaaggaacaggactgtttcaaacacaaatct
gtcttggacacgttcctcaaatgtgatacaaaagatgagtttaccaaacaggaccataga
attgcactgaattgggctcactggtgggatcggcaaacacaggagtgtatccttctcccc
agaataagttcagaagaatataaagcacattccccagaagccctgtggagacacctcaca
gctcgccatgactggtcaagcatcagcttgtggatggaagaatttcaggcccaggaaact
gtgtcacctcagcagagcaagtggcctcctctgagtgctgccgtcatcgagcagaacact
tgctgcagcaggcacatgaggaacgcgatcttagaccagctggccagatgtggcattttt
cttgcatctgagctggaagactttgaacttctcctcctgagactgagccggattgggggt
gtaatgcaggatgccctccccgtgcagagctacagatcctcggcagggtgcaactttgat
tcccaagtcatcctctactgtttagagcacggcctgcagcatcttctctacgtctacctt
gactattacaaacttagccctggaaattgtccctttttggaaaagaaagaactacatgaa
gctcacccttggcttgaatttttggttcagtgtcggcaagtttccagtaacttgacagat
cccaaactgatctttcaggccagtcttgcaaatgctcagatttcgattcccaccaatcaa
gccagtgtgagcagcatgctgttggaaggacacaccctcttggctcttgctaccaccatg
tatgctcctgggggcgtcagccaggtcattcagcatgaagacagcgagaactgtttgaag
aaagtggacccccagctactgaagatggccttaacgccttacccaaagctcaaagccgcg
ctcttccctcagtgcactgctcctagtattctgccctctgacattacactctaccacctc
atccagtccttaccaccctttgatcccagcagactgtttggctggcagtctgccaacact
ctagctatcggagatgcggccggtcagctcccacacttctccagtcctgacctggtgagt
aaatacgccgtggtggagcagctgagctacacgtattacttacatcacggacgcccatcc
ttcgccttcggcacctttctggtccaggagttaatcaagagtaagactcccaagcagctg
atccagcaagtaggcaaggaggcctataccttagggctctcctccttccacaacccttcg
gtaggggccgcctgtgtctgcttcttagaattgcttggcctcagcagcctcaagctcaga
gttgacctgaaaatggcaaacgtagttctgggctccaggcgtagaaatgaagatgcacat
cccagcttcatcagagagtctctggctgagaagctgtctaagcttgctgacggtgacagg
gcaaccacagaagagctgctcgttctcttggaggaaggcgtgtgggacagcattgagcag
cagggctttaacaggttgtccagcgaatccagcagccagtggtcattagtgttacagttc
tgcatgctccatgatatgaaactgagcgtgtcctaccttagagaatgtgccaaagcaaat
gattggctgcagtttctggttcacagccagctccataactaccacccagaagaggtggaa
accctgcttcagtatttcagtcctgtccttcagagtcacttgaagctggcttctgagaaa
ctgtcatcagggtccatctctaaggacgacagctgcctccaggaactccagaaaaacaaa
gaaacaagtgatttctttgaaattctccaccggtgctcggatgagtcagcttcctggtgc
tggctcctggctgaagcagtgagacatcgggttcccatcctcagtgtcctggcctcgtgt
atccagggtgccagtgctgtcccctgtctctgtgtttggattgtcacctctgtggaggac
aaggttgcagctgaagcaatagaacacattcagatctctgtagaggaccatcattggagc
ctcgaggacctgtccattatctggagaactgtattgacaagacggaagatccacactctc
atccgaggcttccggcttttcattaaggattccccacttctcttgattatggaaatgtat
gaactgtgtgtgttcttcaagaactacggaaaagccaaagttaagcttgtggagttccag
aaaagccttgaaatgcttgacacagtggctactcgggtccttcctgtcatacctgccacg
tggatgagggagcaggtgtgcttccttttgaaacttatgccacagcagtgcgagacacag
tatgagctgcagaaagtcctccaactgtttgtcgggatggagcagctcttctccgatggg
ccagacgtgcagaagctgtatcggctcagccaagtactgaaggacacacctatcaccatc
agccctgcagtcatttccagctacagcactgagagtttgcagcgtgagtgtagatctatt
ttggagaagctaaaggcagatggacagtttgctgtggccaggagagtggcagaattagca
tccctgcctgtggacggcttggtgattgaacagttaacgcaggaaatgcaaatgctaaca
cacacccagcagtggtccctgaaacaagcaagacttgacttctggagaaaatgccatgaa
aattttaagaaaaactctgtttcaaacagagcagcctcttccttcttctccagccaagcc
ccggaggcgagtgagcaccctgctgagcagggcagccttgaggagcgccatctgctgctc
actctggcgggccactggcttgcccaagaagagccagttcccgtggaggaactggaggag
ctggagaaacagatttggctctgccgcatcgcccagcacacatgtggaggggctgaagaa
gaaaccaagcccagcctctcgcaacacaagttggcccctgctgaactttcttctgatagc
tcagccagtgagttctccttctccaagcttgctgctttgaacacatccaaatacttagac
cttaatggtcttccatccaaggagatgtgtgagaacacactggaacacagagagcaggag
tcactgaacactttgattgggcagctgctggatggtggctgtgtgcatgaagcgagcaga
gtgtgccggtatttccgtgtctatagtcaggatctagtgctgctgctgcactgcagagcc
ttggcctccgcagaggccagcatggaagatctgcactcagagatccgtgccctcctctca
aatgccacactacctgaggacctggagagccctggcgtccctcttcggaaagtccatagc
agagaaaagcagcctttcaacctagcagaggaaagccagacatttcttcagctaactgct
ttgtgtcaagaccgtacattggtaggcatgaagttgttggacaagattccatctgtcccc
catggggagctgtcatgcaccacagagctcctgatcctggcccatcactgctttacctgt
gcgtgttacatggagggcatcatcagagtcctacaggctgcccggatgcttacagataac
cacttggctcccaatgaggagtatggattggtggtacgcctcctcactggcattggacgg
tacaatgagatgacgtacatattcgacttgctgcatcaaaagcattattttgaagttctg
atgaggaagaagctagatccaaccggcaccctgaaaacagccctactagactacatcaaa
cgctgccaccctggagacagtgaaaagcacaatatgatcgccctgtgcttcagcatgtgt
cgggagataggagagaaccacgaggccgcagcctgcatccaactgaagctgatcgaatct
cagccctgggaggaaagtctcaaggatggagcccaactaaaacagctcctgcttaaagcc
ctgactttgatgctggacgcagcagagagttacgcaaaggactcctgtgtgcggcaggcc
ctgcattgtaaccggctcaccaagttgataacactacagattcactttctcaacagtggc
cagaacacaatgctcatcaacttgggccatcagaagctaatggactgtatcatgacccta
cctcggttctaccaggcttctattgtagctgaggcctatgactttgttcctgattgggct
gaagtactctaccaacaagtgattcttaaaggagactttagttacttggaagaatttaag
cagcagaagttactaaaacccaatatatttgaagacatttccaaaaaatataaacaacac
cagcctactgacagggtcacagaaaacctgaagaagttactttcatattgtgaagacatc
tacctgtattacaagttggcatatgaacacaagttttttgaaattgtaaatatgcttctg
aaggatcctcaaacaggatgctgtcttaaagatatgctcgcgggttag

DBGET integrated database retrieval system