KEGG   Rattus norvegicus (rat): 311374
Entry
311374            CDS       T01003                                 

Gene name
Duoxa1, RGD1306601
Definition
(RefSeq) dual oxidase maturation factor 1
  KO
K17233  dual oxidase maturation factor 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    311374 (Duoxa1)
Membrane trafficking [BR:rno04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    311374 (Duoxa1)
SSDB
Motif
Pfam: DuoxA
Other DBs
NCBI-GeneID: 311374
NCBI-ProteinID: NP_001101237
RGD: 1306601
Ensembl: ENSRNOG00000018005
UniProt: D3ZEH0
Position
3q35
AA seq 340 aa
MAALGHTLPFYTGPKPTFPMDTTLAVIITIFLTALVTFIIILPGIRGKTRLFWLLRVVTS
LFIGAVILAVNFSSEWSVGHINTNTTYKAFSPKRVSVHVGLQIGLGGLNITLTGTPVQQL
NETINYNEEFTWRLGKSYAEEYAKALEKGLPDPVLYLAEKFAPRSPCGLYNQYRLAGHYA
SAMLWVAFLCWLLANVMLSMPVLVYGGHMLLATGLFQLLALFFFSMTTSLMSCPLRLGTA
VLYTHHGPAFWITLATGLLCILLGLVMAVAHRMQPHRLKALFNLSSEDPMLEWGSEEGGL
LSPHYRSIAESPETQDIPMSEASSETCLKEECLKESDCSL
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggctgctcttggacacacgctgcccttctacactggccccaagccaaccttcccaatg
gacaccactttagctgttattatcacaatcttcctgactgccctggtcaccttcatcatc
atcctgcctggcatccgtgggaagacaaggctgttctggctgctacgggtggtgaccagc
ttattcatcggggctgtgatcctggctgtgaatttcagttctgagtggtctgtgggccat
atcaacaccaacacaacctacaaagccttcagtcccaagcgggtcagcgtgcacgtggga
ctgcagattgggctcggaggactcaacatcaccctcacagggaccccagtgcagcagctg
aatgaaaccatcaactacaatgaggagttcacatggcgcctgggcaagagctatgcagag
gagtatgccaaggccttggagaagggccttccagacccggtgctatacctggctgagaag
tttgcccctcgaagcccttgtggcctgtacaaccagtaccgcctggcaggacactacgcc
tcagccatgctgtgggtagcattcctctgctggctgctggccaatgtgatgctgtctatg
ccagtgctggtttatggtggccacatgctgctggccactggcctcttccagctgttggca
ctgttcttcttctccatgaccacgtcactcatgtcctgcccgctgcgcttgggcactgct
gtactgtacactcaccatgggcctgctttctggatcacattagccacaggactgctgtgc
attctgcttggcctggtcatggcagtggcccacaggatgcaacctcacagactgaaggct
cttttcaacctgagctcagaggaccccatgttggagtggggctctgaagaagggggactc
ctgagcccccactaccggtccatagctgagagtccggagactcaggacattcccatgtca
gaggcttcctctgagacgtgtcttaaagaggaatgcctcaaagagtccgactgttccctg
taa

DBGET integrated database retrieval system