KEGG   Rattus norvegicus (rat): 311404Help
Entry
311404            CDS       T01003                                 

Gene name
Ap4e1, RGD1562199
Definition
(RefSeq) adaptor-related protein complex 4, epsilon 1 subunit
  KO
K12400  AP-4 complex subunit epsilon-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    311404 (Ap4e1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    311404 (Ap4e1)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   AP-4 complex
    311404 (Ap4e1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adaptin_N AP4E_app_platf Cnd1 Coatomer_b_Cpla Coatamer_beta_C
Motif
Other DBs
NCBI-GeneID: 311404
NCBI-ProteinID: NP_001178671
RGD: 1562199
Ensembl: ENSRNOG00000022938
UniProt: D3ZX21
Position
3q36
AA seq 1130 aa AA seqDB search
MSDMVERTLTALPGLFLQNQLGGPAASRAPFFSRLGGLIRGVTALSSKHEEEKLIQQELS
SLKATVSAPTTTLKMMKECMVRLIYCEMLGYDASFGYIHAIKLAQQGNLLEKRVGYLAVS
LFLHESHELLLLLVNTVVKDLQSTNLVEVCMALTVVSQIFPREMIPAVLPLIEEKLQHSK
EIIRRKAVLALYKFYLIAPNQVQHIHTKFRKALCDRDVGVMAASLHIYLRMIKENSSGYK
DLTESFVTILKQVVGGKLPVEFSYHSVPAPWLQIQLLRILGLLGKDDERTSELMYDVLDE
SLRRAELNHNVTYAILFECVHTIYSIYPKSELLEKAAKCIGKFVLSPKINLKYLGLKALT
YVIQQDPSLALQHQITIIECLDHPDPIIKRETLELLYRITNAQNVVVIVQKMLEYLHQSK
EEYIIINLVGKIAELAEKYAPDNVWFIQTMNAVFSVGGDVMHPDILSNFLRLLAEGFDDE
TEDQQLRLYAVQSYLTLLDMENTFYPQRFLQVMSWVLGEYSYLLDRESPEAVMTRLYKLL
RSDSISSETKAWLFAAVTKLTPQAHSSPIVENLIQEFTVSLNTCLRQHAFELKHLHENEE
LMKSLLQSAQNCDDIMADASLSFLDGFVAEGLSQGAAPYKPRHQRQEEQLSQEKVLNFEP
YGLSFSSSGFTGRQSPAGVSLGSDISGNSAETGLKEAGSLKMDGIKKLWGKEGYLPKKES
GAADKLEAAHAPAESAMMENVDQAMTRKDQAQGHTPSTEEKEKQLLASSLFVGLGPENTI
NLLGKADVVSYKFRRKSKPKVAQSDKMPSAHAAPSSTLSPVSDVAGGDEDSLSAADRGDG
ELGSELLGSESVLELPSVENLSSVSLPVSSLFAGNDMEVFHPPSSSATSAVKEVSLAALL
EETPECRRSALVEICSNETVAVSSYKVWKDECLLLVCSVTSKTDSEFTDAQLEIFPLENF
KIIEQPGCPSPVMEAESTKSFQYGVQMESPCVEGTLSGFIKYQMMDTHPVQLEFSMNLSL
LDFIRPLKISTEDFGKLWLSFANDVKQNIKISEPRVALASVLTELQQKLRLCVVDVIGSE
GLLACKLLPSTPCILHCRVHADVVALWFRSSSSVLSDCLSCHCQKVMQTS
NT seq 3393 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatggtggagaggacgctgaccgcactgccggggctcttcttgcagaaccag
ctgggagggcctgcggcctccagagcacccttcttctccaggctgggcggcctcatccgt
ggcgtcactgcgctctcatccaagcacgaagaagagaagttaatccagcaggaactgagt
agtctgaaggcgactgtttctgctcctactacaacactgaaaatgatgaaggaatgtatg
gtgagacttatatactgtgagatgcttggatacgatgcttcttttggttatatacatgca
atcaagttggcccaacaaggaaacctcttagaaaaaagagtgggttatttggctgtttct
ctgtttctacatgaaagtcatgaacttttgcttctccttgtgaatacagtggtaaaggac
ctgcagagcactaatctggtagaagtgtgtatggcactcactgtcgtcagccagattttc
cctcgagaaatgattccagctgtccttccactaatagaagagaaactccaacattctaag
gagattatacgaagaaaagcagttctggcattatacaaattttatctcattgcccctaat
caagtacagcatatccatactaagtttcggaaagcactctgtgacagagatgttggggtc
atggctgcctctttgcatatataccttaggatgattaaggaaaattcttctggatataaa
gacttgactgagagttttgtaacaattttaaagcaggtggtggggggaaagctccctgta
gagttcagttaccacagtgtgccagcgccatggttacagattcagctcttgagaatactg
ggactgctgggaaaagacgatgaaaggacaagtgaactaatgtatgatgttcttgatgaa
tccttacgaagagccgagttaaatcacaatgtcacttacgctattctgtttgagtgtgta
cacacaatctattctatttatcctaaatcagaattacttgagaaggctgccaagtgcatt
ggaaaatttgttctgtcacctaaaataaacctcaaatatttaggactgaaggctcttacc
tatgttatccagcaggatccttctctggctcttcaacaccagataaccataattgaatgc
ctagaccaccctgatcccattattaaaagagagactctggaacttctttacagaattaca
aatgcacagaatgtagtagttattgtacagaaaatgcttgaatatttacatcagagcaaa
gaagagtacatcatcatcaacttagtcggcaaaatagctgaattggctgagaaatatgct
cctgacaacgtgtggttcattcagacgatgaatgctgtgttttcagtgggaggagatgta
atgcacccagacattctcagtaactttctgagactgctagcagaaggttttgatgatgaa
acagaagatcaacagttaagactctatgcagttcagtcttacctcaccttactagacatg
gaaaacactttctatccacagagatttcttcaagttatgagttgggtattaggagagtat
tcctacctcttagatagagaaagccccgaggcagttatgaccaggctctacaagttactg
aggagtgactccatttcttcagaaacgaaagcatggttgtttgctgcagtaaccaagtta
acacctcaagctcattcttctcccatagttgagaacttaatccaagaattcactgtatcc
ttgaatacttgtctgagacaacatgcatttgaattgaaacatctacatgaaaatgaagag
cttatgaagagcttgcttcagagtgctcagaattgtgacgacatcatggcagatgcttct
ttatcttttctggatggttttgtggctgaaggactcagtcagggagcagcaccttataag
ccccgtcaccagcgccaagaggagcagctctctcaggaaaaagttctcaattttgaacca
tatggactatcattttcttcatctggcttcactggacgacagtctcctgctggcgtttct
ctgggctcagatatatctggaaacagtgctgaaacagggctgaaagaggcaggtagcctg
aagatggacggcataaagaaattatggggtaaagaaggttatctccccaagaaggagagt
ggagctgctgataaactggaagccgcacatgctcctgcagagagtgcaatgatggagaat
gtagaccaagccatgactaggaaggaccaagctcaaggccacaccccttctacagaggag
aaagaaaagcagctgttggcatcatcgctgtttgttgggctaggaccagaaaatacgatc
aatttgttgggaaaagcagatgttgtgtcttacaagttcaggaggaagtcaaaacccaag
gtagcccaaagtgacaagatgcccagcgctcatgccgctccctcctccacccttagccct
gtgtccgatgtggctgggggggatgaggacagtctgagcgctgcggatagaggagacggg
gagcttggttcagagctgttgggttctgagtctgtcttggagctgccctcagttgaaaac
ctctcgagtgtcagcttgcccgtgtcttctttgtttgcgggtaacgacatggaagtattt
catcccccttcatcctctgcaacttcagccgtcaaggaagtcagtttggctgctctgttg
gaagaaactcctgaatgcaggcgttcagctctcgtggaaatctgtagtaatgaaactgtg
gctgtgtcttcttacaaagtctggaaggatgagtgtttattgctggtgtgctcagtcact
agtaagactgattcagagttcacagatgctcaattagaaatttttcctttggaaaatttc
aagatcattgagcagcctggatgtccttcacctgtgatggaagcagaaagcaccaaatcc
ttccaatatggcgtgcagatggaaagcccttgtgtagaggggactctctctggttttata
aagtatcaaatgatggatacacatcctgttcaactggaattttccatgaacttatcacta
ctagattttattaggccattaaagatctcaactgaagactttggcaaactctggttgtct
tttgcaaatgatgtgaagcaaaatataaaaatatcagagcctcgagttgcactggcttct
gtcctgacagagctgcagcagaaactcagactttgcgtggttgacgtcataggcagtgaa
ggtctgctggcctgtaagctgcttccgtccaccccctgtatcctgcactgccgagtacac
gctgacgtggtagccctgtggttccgatcctctagctctgttctttcagactgtttatct
tgtcactgtcagaaagtgatgcagacatcctag

DBGET integrated database retrieval system