KEGG   Rattus norvegicus (rat): 311422
Entry
311422            CDS       T01003                                 

Gene name
Itpa
Definition
(RefSeq) inosine triphosphatase
  KO
K01519  inosine triphosphate pyrophosphatase [EC:3.6.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    311422 (Itpa)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    311422 (Itpa)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     311422 (Itpa)
SSDB
Motif
Pfam: Ham1p_like
Other DBs
NCBI-GeneID: 311422
NCBI-ProteinID: NP_001101244
RGD: 1589751
Ensembl: ENSRNOG00000021233
UniProt: D3ZW55
Position
3q36
AA seq 198 aa
MAASLVGKKIVFVTGNAKKLEEVIQILGDKFPCTLVAQKIDLPEYQGEPDEISIQKCQEA
ARQVQGPVLVEDTCLCFNALGGLPGPYIKWFLQKLKPEGLYQLLAGFEDKSAYALCTFAL
STGDPSQPVLLFRGKTPGQIVMPRGSRDFGWDPCFQPDGYEQTYAEMPKAEKNTISHRFR
ALFKLQEYFGVTDGAGDH
NT seq 597 nt   +upstreamnt  +downstreamnt
atggccgcgtctttggttgggaagaagatagtgtttgtgacgggaaacgcaaagaagctg
gaggaggtcattcagattctaggagataagtttccatgcactttggtggcgcagaaaatt
gacctgcctgagtatcagggagaaccggatgaaatttccatacagaagtgtcaggaggca
gctcgacaggtgcagggccctgttctggtggaggatacctgtttgtgctttaatgcactt
gggggactgcctggcccctacataaaatggtttctgcagaagctgaagcctgaaggtctc
taccagctcctggccggctttgaagacaaatcagcctatgcactctgcacattcgctctc
agcactggggaccccagccagccagtgctcctgttcagaggcaagaccccgggacagatt
gtgatgcctcgaggtagccgggacttcggctgggatccctgctttcagcctgatggatat
gagcaaacgtatgcagagatgccgaaggctgagaagaacaccatttcccatcgcttccgg
gctctgttcaagctccaagagtactttggtgtgactgatggggctggggaccactag

DBGET integrated database retrieval system