KEGG   Rattus norvegicus (rat): 311430
Entry
311430            CDS       T01003                                 

Gene name
Mavs
Definition
(RefSeq) mitochondrial antiviral-signaling protein
  KO
K12648  mitochondrial antiviral-signaling protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    311430 (Mavs)
   04622 RIG-I-like receptor signaling pathway
    311430 (Mavs)
   04623 Cytosolic DNA-sensing pathway
    311430 (Mavs)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    311430 (Mavs)
   05160 Hepatitis C
    311430 (Mavs)
   05171 Coronavirus disease - COVID-19
    311430 (Mavs)
   05164 Influenza A
    311430 (Mavs)
   05162 Measles
    311430 (Mavs)
   05168 Herpes simplex virus 1 infection
    311430 (Mavs)
   05169 Epstein-Barr virus infection
    311430 (Mavs)
SSDB
Motif
Pfam: CARD_2
Other DBs
NCBI-GeneID: 311430
NCBI-ProteinID: NP_001005556
RGD: 1359371
Ensembl: ENSRNOG00000025295
UniProt: Q66HG9
Position
3
AA seq 507 aa
MTFAEEKTYKYIRYNHSKFCCVDVLEILPYLSCLTTSDQDRLRASYKQLGNQGTLWELFN
TLQRRPGWVEVFIRALRICELPGLAEQVTRVYQSYLPPGASLHSLDPLQSPRIPTTVSEP
SAFAAGHTIPDSGFQDKPGYPKPVQDTQPPKSPVENSEEPPQANFGAIPRMSGDSLISSP
NPPALSPQPSREHPEQEPELGGPSTANVDSVPIATYGPVSPTVSFQPLPRIAPRTNLSPG
VTVSALSAKTTLSSSSTGSAFAKGAGDQAKAATCVSTKEGVPTNSVTTSSVPSIKPVPVN
TMSSKLPISTKSTAATPSTVPTNIAPSKLPINSVYTGIVPSKVTASVAKASASTMPPERN
NKQAKETLEAPATVVTTGSSLTRPDISSRSLHSGPELSKPGVLVSQVDNEPFSACSMDLA
ISPSTSLGSEPNHGPEENEYSSFRIQVDKSPSVDLLGSPEPLATQQSPEEEEPCASSVSW
AKWLGATSALLAAFLAVMLYRSRHLAQ
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgacatttgctgaggaaaagacctataagtatatccgctacaaccacagcaagttttgc
tgtgttgatgttctggagatcctgccttacctgtcctgcctcacaaccagtgaccaggat
cgattacgggcttcctacaagcaactaggaaaccagggcacactctgggaactcttcaat
acgctccagcgtcggcctggctgggtagaggtcttcatccgggcactgaggatctgtgag
ctgcctgggctggctgagcaagtgactcgagtttatcagagctacctgcctcctggggcc
tcactccactccctagacccattgcagtcaccaagaattcctaccacggtttccgaacct
tctgcatttgcagcaggccacaccatccctgacagtggcttccaagataaaccaggttac
cctaagcctgtccaggacacccagccaccaaagtccccagtagagaattcggaggaaccc
ccacaggccaactttggggccattccaaggatgtcgggtgactctttgatatcctcacct
aacccaccggccctcagccctcagccctccagagagcatcccgagcaagaacccgaactg
gggggcccctccacagcaaatgttgactctgttcccatagcaacctatggacctgtgtct
ccaactgtttccttccagccccttccacgtattgccccgaggacaaacctctcgcctggg
gtcacagtatcagctctatctgccaagaccactttgtcctcctcttctactggatcagct
tttgcaaagggagcaggtgaccaggccaaggctgccacctgtgtcagcactaaagaggga
gtacctaccaattctgtgactaccagctcagtgccttccatcaaaccagtaccagtaaat
accatgtcttccaagttgcccatcagtacaaagtccactgctgcaacgccctctactgtg
cccactaatatagcgccatcaaaattacccatcaactcagtatatactggcatagtgcca
tccaaagtgactgctagtgtggccaaagcaagtgccagcacaatgccacctgagaggaac
aacaagcaagccaaggagaccctggaggctccagcaaccgtagtcaccactggaagcagc
ctgaccagaccagatatcagttccaggagcttgcactctgggccagagttaagcaagcca
ggggtgctggtgtcccaggtggacaacgagccattctcagcctgctctatggaccttgcc
atcagccctagcacctccttgggctcagaacccaaccatggtccagaggagaatgagtat
tcatcctttcgaatccaggtggataaaagtcccagtgttgatctgttaggaagccctgag
ccactagccacccagcagtccccagaagaggaagagccttgtgccagttcagtgtcctgg
gctaagtggctgggggccaccagtgcactcttggctgcattcctggcagtgatgctctac
cgtagcaggcacctggcccagtga

DBGET integrated database retrieval system