KEGG   Rattus norvegicus (rat): 311446Help
Entry
311446            CDS       T01003                                 

Gene name
Hao1, Gox1, XDH1
Definition
(RefSeq) hydroxyacid oxidase 1
  KO
K11517  (S)-2-hydroxy-acid oxidase [EC:1.1.3.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00630  Glyoxylate and dicarboxylate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    311446 (Hao1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    311446 (Hao1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     311446 (Hao1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FMN_dh IMPDH ThiG Glu_synthase Dus His_biosynth TMP-TENI NMO Fer2_4 DHO_dh
Motif
Other DBs
NCBI-GeneID: 311446
NCBI-ProteinID: NP_001101250
RGD: 1589750
Ensembl: ENSRNOG00000004601
UniProt: B0BNF9
Position
3q36
AA seq 370 aa AA seqDB search
MLPRLVCISDYEQHARTVLQKSVYDYYKSGANDQETLADNIRAFSRWKLYPRMLRNVADI
DLSTSVLGQRVSMPICVGATAMQCMAHVDGELATVRACQTMGTGMMLSSWATSSIEEVAE
AGPEALRWMQLYIYKDREVSSQLVKRAEQMGYKAIFVTVDTPYLGNRFDDVRNRFKLPPQ
LRMKNFETNDLAFSPKGNFGDNSGLAEYVAQAIDPSLSWDDIKWLRRLTSLPIVVKGILR
GDDAQEAVKHGVDGILVSNHGARQLDGVPATIDALPEIVEAVEGKVEVFLDGGVRKGTDV
LKALALGARAVFVGRPIIWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQNVKVIDKTLV
RKNPLAVSKI
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgttgcctcggctggtctgcatcagtgactatgaacagcatgcccggacagtgcttcag
aagtcagtatatgattattacaagtctggggcaaatgaccaggagactttggctgataat
atcagagcattttctaggtggaagctctatccacggatgctgcgcaacgttgctgatatc
gacctgtcgacttctgttttaggacagagagtgagcatgccaatatgcgttggggctacg
gctatgcagtgcatggctcatgtggatggggagctggccactgttcgagcctgtcagacc
atgggaactggcatgatgttgagttcctgggccacttcctcaatagaagaggtggcagag
gctggcccggaggcacttcgctggatgcaactctacatctacaaagatcgtgaggtcagc
agtcagctagtgaagagggctgagcagatgggttacaaggccatatttgtgactgtggac
accccttacctgggaaatcgcttcgatgatgtgcggaacaggttcaagctaccaccacag
ctcaggatgaaaaactttgaaaccaacgatttggcattttctcctaaggggaattttgga
gacaacagtggccttgctgaatatgtggcacaagccatagacccatctctcagctgggat
gatattaaatggctcagacggttgacctcactgcccattgttgtaaagggaattttgaga
ggtgatgatgcccaggaagctgttaaacatggtgtggatgggatcttagtgtcgaatcat
ggggcacgacaactggatggggtgccagctactattgatgccctgccagagatcgttgag
gctgtggaagggaaggtagaagtcttcctggatgggggagtcaggaaaggcaccgatgtt
ctcaaagctctggccctgggagccagagctgtttttgtggggagacccatcatctggggc
ttggctttccagggggagaaaggtgttcaagatgtcctcgagatactgaaggaagagttc
cggctggccatggctctgagtgggtgccagaatgtgaaagtcatcgacaagacattggtg
aggaaaaatcctttggctgtttccaagatctga

DBGET integrated database retrieval system