KEGG   Rattus norvegicus (rat): 311487
Entry
311487            CDS       T01003                                 

Gene name
Polr3f
Definition
(RefSeq) DNA-directed RNA polymerase III subunit RPC6
  KO
K03025  DNA-directed RNA polymerase III subunit RPC6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    311487 (Polr3f)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    311487 (Polr3f)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    311487 (Polr3f)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     311487 (Polr3f)
SSDB
Motif
Pfam: RNA_pol_Rpc34 TrmB CDC24_OB1 TFIIE_alpha
Other DBs
NCBI-GeneID: 311487
NCBI-ProteinID: NP_001101254
RGD: 1306428
Ensembl: ENSRNOG00000007548
UniProt: D3ZQ56
Position
3
AA seq 371 aa
MGAPSRPHEEGPARPKEEGPSSLPRPHPWRAPPPVPENSSALLRATFPLVLKTTLMAEVK
VKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQRAVAINRLLSMGQLDL
LRSNTGLLYRIKDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDIRYKSNLPLTEINK
ILKNLESKKLIKAVKSVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFVEVLNQQCF
KFLQSKAETARESKQNPVIQRNSSFASSHEVWKYICELGISKVELSMEDIETILNTLIYD
GKVDMTIIAAKEGTVGSVDGHMKLYRAVNPILPPTGLVRAPCGLCPVFDDCHEGGEISPS
NCIYMTEWLEF
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgggcgccccaagccgacctcatgaagaaggcccggcgcgaccgaaggaagaaggtccc
tcgtccctcccacgcccccacccctggcgtgcgcctccaccggttcccgagaattccagc
gcgctcctccgggccacttttcctctagtcttgaaaaccaccctcatggcggaggtgaag
gtgaaggtgcagccgccggacgcggatccggtggaaatagaaaacagaattatagaatta
tgccaccagttccctcatggaatcacagatcaagtaattcagaatgaaatgcctcacata
gaagcccagcaacgggcagtggccatcaatagactattgtccatgggtcagttggatctt
ttacggagtaatacaggccttttatatagaataaaggattctcagaatgctggtaaaatg
aaggggtccgataaccaggaaaagctagtctaccaaatcatagaggatgcagggaataaa
ggaatatggagcagagatattcggtacaaaagcaacttgccattaacagaaatcaacaaa
attctcaagaatttggaaagtaaaaagcttattaaagctgtgaagtctgtagcagcttcc
aaaaagaaggtttacatgctctataacctgcagccagaccggtctgtgactggcggggcc
tggtacagtgaccaggattttgaatctgaatttgttgaggtgcttaatcaacagtgtttc
aaattcctacagagcaaggcagagactgcaagagaaagtaaacagaatccagtgatacaa
agaaacagttcatttgcttcatcacatgaagtgtggaagtacatctgtgaactgggcatc
agtaaggtagagttgtccatggaggacattgaaaccatcttgaacacactcatttatgat
ggcaaagtggatatgactatcattgctgccaaggaaggcactgttgggagcgttgatgga
cacatgaaactgtacagggcagtcaacccaatcctcccacctacaggcttggtccgggca
ccctgtggactctgtcccgtttttgatgactgccatgaaggtggtgaaatttcaccatct
aattgtatttacatgacagagtggctcgaattttaa

DBGET integrated database retrieval system