KEGG   Rattus norvegicus (rat): 311491Help
Entry
311491            CDS       T01003                                 

Gene name
Scp2d1, RGD1308385
Definition
(RefSeq) SCP2 sterol-binding domain containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: SCP2 Alkyl_sulf_C
Motif
Other DBs
NCBI-GeneID: 311491
NCBI-ProteinID: NP_001101255
RGD: 1308385
Ensembl: ENSRNOG00000009461
UniProt: D3ZCM8
Position
3q41
AA seq 156 aa AA seqDB search
MWKRTDPQAKIKAGDRPQTCHSLALGSATESALPHPLELSDFQSFSVFEDISHHIKEGGA
QLVKKVNAIFQLDITKDGKTILQWTIDLKNGSGDMYLGSARLPADTIFIIPDTVFTELVV
GKMNPQKAFLAGKFKVRGKVLLSQKLERIFREWAKF
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagagaactgatcctcaagccaagatcaaagcaggggataggcctcagacttgc
cattctctggctctgggatcggccacagagtcggcactgccccaccctctagaactgtca
gacttccagagcttttcagtatttgaggacattagccatcacatcaaagaaggaggagcc
caactggtaaagaaagtgaatgccatctttcagcttgacatcaccaaagatgggaagacc
attctgcagtggaccattgacctcaagaacggttcgggggacatgtacctgggatcagcc
cggcttcctgcagacaccatcttcatcatccctgacacggtcttcacagagttagttgtg
ggtaagatgaacccacagaaggctttcctggctggcaagtttaaagtgagaggcaaagtt
ctccttagccagaagctggagaggatcttcagagagtgggctaaattttaa

DBGET integrated database retrieval system