KEGG   Rattus norvegicus (rat): 311545Help
Entry
311545            CDS       T01003                                 

Gene name
Hm13, H13
Definition
(RefSeq) histocompatibility minor 13
  KO
K09595  minor histocompatibility antigen H13 [EC:3.4.23.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    311545 (Hm13)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     311545 (Hm13)
Peptidases and inhibitors [BR:rno01002]
 Aspartic peptidases
  Family A22: presenilin family
   311545 (Hm13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_A22B SPP DUF4345 Presenilin
Motif
Other DBs
NCBI-GeneID: 311545
NCBI-ProteinID: NP_001101259
RGD: 1308946
Ensembl: ENSRNOG00000007738
UniProt: D3ZP98
Position
3q41
AA seq 364 aa AA seqDB search
MDSALSDPHNGSSEAGTPANGTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSVRCARG
KSSSDMPETITSRDAARFPIIASCTLLGLYLFFKLFSQEYINLLLSMYFFVLGILALSHT
ISPFMNKFFPANFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSVVGVWYLLRK
HWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPI
KLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDISLKKNTHTYFYTSFAAYIF
GLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALVKGEVAEMFSYEESNPKDPAAILLS
QKHR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggattcggccctcagcgacccgcacaacggcagcagcgaggctggcaccccagccaac
ggcacgacgcggccgccctccacacccgagggcattgcgctggcctacggcagcctcctg
ctcatggcgctgctgcccatcttcttcggcgccctgcgctcggtgcgctgcgcccgcggc
aagagctcttcggacatgccagaaaccatcaccagccgagacgctgcccgcttccccatc
atcgccagctgtacactcttggggctctacctctttttcaaactgttctcccaggagtac
atcaacctcttgctgtccatgtatttcttcgtgctggggatcctggccctgtcccacacc
atcagccccttcatgaataagttttttccagccaacttcccaaatcgccagtatcagctg
ctcttcacacagggctctggggaaaacaaggaagagatcatcaactatgagtttgacact
aaggacctggtgtgcctgggcctaagcagcgtcgttggtgtctggtaccttctaaggaag
cattggattgccaacaacctgtttggcctggccttctcccttaatggggtagagctcctg
cacctgaacaacgtgagcactggctgtattctgcttggaggactcttcatctatgacatc
ttctgggtattcggcaccaacgtgatggtgactgtggccaagtcctttgaggcaccaata
aaattggtgttcccccaggatctgctggagaagggtcttgaagcagacaactttgccatg
ctgggacttggagacattgtcatcccagggatcttcatcgccttgctgctccgtttcgac
atcagcctgaagaagaacacccacacctacttctacaccagcttcgctgcctacatcttc
ggcctgggtctcaccatcttcatcatgcacatcttcaagcacgcccagccggccctcctg
tacctggtccctgcctgcatcggttttcctgtcctggtggcactggtcaagggagaagtg
gcagagatgttcagttatgaggagtctaaccctaaagatccagcagccattctgttgtct
caaaaacatagataa

DBGET integrated database retrieval system