KEGG   Rattus norvegicus (rat): 311617
Entry
311617            CDS       T01003                                 

Gene name
Fitm2, Fit2, RGD1307696
Definition
(RefSeq) fat storage-inducing transmembrane protein 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Scs3p UNC-50 ARL6IP6 PAP2 DUF2070
Other DBs
NCBI-GeneID: 311617
NCBI-ProteinID: NP_001101269
RGD: 1307696
Ensembl: ENSRNOG00000027434
UniProt: D3ZWT2
Position
3q42
AA seq 262 aa
MEHLERCAWFLRGTLVRAAVRRHLPWVLVAAMLVGSALKELSPLPESYLSNKRNVLNVYF
VKLAWAWTVCLLLPFIALTNYHLTGKTSLVLRRLSTLLVGTAIWYMCTALFSNIEHYTGS
CYQSPALEGIRQEHRTKQQCHREGGFWYGFDISGHSFLLTFCALMIVEEMAVLHEVKTDR
SHHLHVAITTLVVALGFLTFIWVWMFLCTAVYFHDLIQKVFGTMFGLLGWYGTYGYWYLK
SFSPGLPPQSSSLTLKQDTYKK
NT seq 789 nt   +upstreamnt  +downstreamnt
atggagcacctggagcgctgtgcgtggtttctccgcgggacgctcgtgagggcggcggtg
cggcgccacctgccctgggtgctcgtggccgccatgctggtgggctcggccctcaaggag
ctgtccccgctgcccgaaagctacctcagcaacaagcgcaacgtcctcaacgtgtatttt
gttaaattggcctgggcctggacagtctgtctcctcctgcctttcattgccctcaccaac
taccacctgacgggcaagaccagcctggtcctgcggcggctgagcaccctcctcgtgggc
acggccatctggtatatgtgcacagccctcttctccaacattgagcactacacaggcagt
tgctaccagtccccggccctggagggcatcagacaggaacaccggaccaagcagcagtgc
caccgggaagggggcttctggtacggctttgacatctcaggccactccttcctactgacc
ttctgcgcgctcatgatcgtggaggagatggccgtgctgcacgaggtgaagacagatcgc
agccaccacctccatgttgccatcaccaccctggttgtcgccctgggcttcctgaccttc
atctgggtgtggatgtttctgtgcacggccgtctatttccacgacttgatccagaaagtg
ttcggcaccatgtttggcttgttgggctggtacgggacatacggctactggtatctgaag
tctttctctcccgggcttcctccccagagctccagtttgactttgaagcaagatacttac
aagaaatga

DBGET integrated database retrieval system