KEGG   Rattus norvegicus (rat): 311785
Entry
311785            CDS       T01003                                 

Gene name
Psd4
Definition
(RefSeq) pleckstrin and Sec7 domain containing 4
  KO
K12494  PH and SEC7 domain-containing protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    311785 (Psd4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    311785 (Psd4)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    311785 (Psd4)
SSDB
Motif
Pfam: Sec7 PH_9 PH
Other DBs
NCBI-GeneID: 311785
NCBI-ProteinID: NP_001128353
RGD: 1310289
Ensembl: ENSRNOG00000006079
UniProt: D3ZPP3
Position
3p13
AA seq 1007 aa
MMGDHLRPMEFLNICLEDNLQPHPEAYPSEVHGHPGPSEPCQEHTWPFDPPESARPDAHH
GDSDVEPSHLGNRLVHGEASQAPASSRSLEDNSSLGSPQQNRSSSTQVVFWAGILQAQMC
VLDLEEELEKTEGLKAGLRCCIPPPSKDFLGDVGLKPSRPKEDEDSGDDSSGSEEENQTW
PKKKMPGSSPEWGAEEDSIFFDNPLFLESPCSDTSTEGECFSWGYPNSHLDMKTWPHRPQ
TLDSPLQEGTGLWTQENDLDLGSNTADHSRCSTPPFPVPSYKMHPCLALGSTEGAPIVPP
DQVGETSWEDDVGPGSPKAPSVDHELIQESDNFGSDLRPATTHPVQPWGSQIPQSLSDLA
PPLHEDLQDPSRPQKPLISQNGGERDAGCFQEPMLCTLAPWGSQASLLEPSCPESGGRGS
GPRPSPVSSQESSPQDQLHSLKWPQDTSHPSLLEKDKSELSSLKKDETEEVPSLMQEAEC
EDTSRSEDASVTEHHVHLASAEGLPESPMPPEEAQSPEEDWRPSPSREKMANSIRNDEGA
WNLALRLYQLNGFRKSEVAAHLRKNNDFSRAVAEAYLSFFQFEGQSLDRALRGFLQALVL
SGETQERERILYQFSKRFHYCNPGAFPSVDSVHTLTCAIMLLNTDLHGQNIGKSMSCQEF
VTNLNGLQDGGNFPKELLKALYWSIRSEKLEWAVDEEDAARPEKDQPSPSAGKISSPFLQ
LAQDPTMPTYKQGILARKMHHDADGKKTPWGKRGWKMFHTLLRGMVLYFLKGEGQWLDGE
SLVGHMMDEPVGVHHSLASPATHYTKKPHVFQLRTADWRLYLFQAPTAKEMASWIARINL
AAATHSAPPFPAAVGSQRRFVRPILPMGPAQSSLEEQHRSHENCLDAASDDLLDLQRNLP
ERRGRSRELEEYRLRKEYLEHEKTRYETYVQLLVARLHFPLKDLALWEDQLGNEADSCQE
PRPSLKKSHSSPSLHQDEAPTTAKVKRNISERRTYRKIIPKRNRNQL
NT seq 3024 nt   +upstreamnt  +downstreamnt
atgatgggggaccacctcagacccatggaatttctcaatatttgcttggaagacaaccta
cagccccatccagaagcatatccaagtgaagtgcatggccatccgggcccttctgaacct
tgccaggaacatacttggccatttgacccccctgaatctgccaggcctgatgctcatcat
ggcgactctgatgtggaacccagtcacctgggaaaccgcctggtgcatggggaggccagc
caggccccagcatcatcgaggtcactagaggacaacagctctctggggagtccacagcag
aaccggagctcatccacccaggtggtattctgggctggcatcctgcaggcccagatgtgt
gtcctggacctggaggaggagctagagaaaacagagggactcaaagcaggactcagatgc
tgtattccaccgccctctaaggacttccttggtgatgtgggcctgaaacccagtcggccc
aaggaggatgaagactctggggatgacagcagtgggtctgaggaagagaaccagacctgg
ccaaagaagaaaatgccaggctcctccccagagtggggtgctgaggaggacagcatcttc
tttgataatcccctcttcctggaaagcccttgctcagacaccagcactgaaggagaatgc
ttttcctggggctacccgaattcccacctagatatgaagacctggcctcataggcctcaa
accctggattctcctctccaagaaggcacagggctctggacgcaagaaaatgatctggat
ttggggagcaacactgctgaccatagtaggtgctccacccctccattccctgtgccttcc
tataagatgcacccctgcttggccttaggatccactgaaggagctcccatagtacctcct
gatcaggtgggtgagacttcttgggaagatgatgttggccctggctcacctaaagcaccc
tctgtagaccatgaattgatccaggaatcagataactttggatctgaccttagacctgcc
acaacacatcctgtacagccttggggctcacagataccccaaagcctttctgacctggcc
ccacccttacatgaggacctgcaggatccttccaggccccagaagcctcttatctcccag
aacggaggtgagagggatgctggctgtttccaggagcccatgctctgcaccttggccccc
tgggggagccaagcatctttactggagcctagctgcccagaatctgggggcagaggctct
ggaccccggcccagtcctgtgtcttctcaggagagcagtccacaggatcagctccatagc
ctcaagtggccacaagatacctcacacccttcgctcctggagaaggataaatcagaattg
agttccctgaagaaagatgagacagaggaagtcccaagcctgatgcaggaggcagagtgt
gaagatacatccagaagtgaagatgcttcagtcaccgagcaccatgttcacttggcttct
gcagaaggacttcctgagagccccatgcccccagaggaagctcaatccccagaggaagac
tggaggccatcaccatctagagagaagatggctaatagcatcagaaatgacgagggggct
tggaacctagccttgcgcctctatcaactgaatggttttcggaagtccgaagtggctgca
caccttcgcaagaacaatgacttcagcagggctgtagccgaggcctacttgtccttcttc
cagttcgaaggtcagagcctggaccgagccctccgtggtttcctccaggccctggtgctc
agtggagagactcaggagcgggaacgaattctctaccaattttccaaacgcttccattac
tgcaatcctggagccttcccctcagtagattctgtacacaccttgacctgtgcaattatg
ctccttaacacagacttacatggacagaacattggaaagagcatgagctgtcaggaattt
gtaaccaacctgaatggcctgcaggatggtggaaacttccccaaagagctgctgaaggct
ctctactggtctatccgaagtgagaagcttgagtgggctgtagatgaagaagatgcagcc
agacctgagaaagaccagccctctccctcagctggcaagataagcagccccttcctgcag
ttggctcaggaccccacgatgcccacctataagcagggtatcctggcacggaagatgcat
catgatgctgatggcaagaagacaccatggggcaaacgaggctggaagatgtttcacacc
ttactgagagggatggtgctctacttcctgaagggagagggccagtggctggatggggag
agtttggttggacatatgatggatgaacctgtgggagtgcaccactcgctagccagccca
gccacccactacaccaagaagccacatgtcttccagcttcggactgcagactggcgtctc
tacctcttccaggcacccacggccaaagaaatggcttcctggattgcacgaatcaacctg
gcggctgccacacactcagcacctccctttccagctgcagtgggctcccagcgcagattc
gtgaggcccatcctgcccatgggcccagcgcagagctccctggaggagcagcatcgatcc
cacgagaactgcctggatgctgcctcagatgacctgttggatttgcagagaaacctgcca
gagcgaaggggccgcagccgcgagttggaggagtaccgcttacggaaggagtatctggag
cacgagaaaactcgatatgagacgtacgtgcagcttctggtggcccgcctacacttccct
ctgaaagacctggctttgtgggaagatcagcttgggaacgaagctgatagttgtcaggag
cccaggccaagcctgaagaagtcccactcaagcccatccctgcaccaggatgaggccccc
accacagccaaggtgaaacgtaacatctcagagcgcagaacctaccggaagatcattccc
aagaggaaccgcaaccagctgtga

DBGET integrated database retrieval system