KEGG   Rattus norvegicus (rat): 311786
Entry
311786            CDS       T01003                                 

Gene name
Traf2
Definition
(RefSeq) Tnf receptor-associated factor 2
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04064  NF-kappa B signaling pathway
rno04071  Sphingolipid signaling pathway
rno04141  Protein processing in endoplasmic reticulum
rno04210  Apoptosis
rno04217  Necroptosis
rno04380  Osteoclast differentiation
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno04920  Adipocytokine signaling pathway
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno05010  Alzheimer disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05132  Salmonella infection
rno05135  Yersinia infection
rno05160  Hepatitis C
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    311786 (Traf2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    311786 (Traf2)
   04064 NF-kappa B signaling pathway
    311786 (Traf2)
   04668 TNF signaling pathway
    311786 (Traf2)
   04071 Sphingolipid signaling pathway
    311786 (Traf2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    311786 (Traf2)
   04217 Necroptosis
    311786 (Traf2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    311786 (Traf2)
   04622 RIG-I-like receptor signaling pathway
    311786 (Traf2)
   04657 IL-17 signaling pathway
    311786 (Traf2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    311786 (Traf2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    311786 (Traf2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    311786 (Traf2)
   05203 Viral carcinogenesis
    311786 (Traf2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    311786 (Traf2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    311786 (Traf2)
   05016 Huntington disease
    311786 (Traf2)
   05017 Spinocerebellar ataxia
    311786 (Traf2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    311786 (Traf2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    311786 (Traf2)
   05135 Yersinia infection
    311786 (Traf2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    311786 (Traf2)
   05160 Hepatitis C
    311786 (Traf2)
   05168 Herpes simplex virus 1 infection
    311786 (Traf2)
   05163 Human cytomegalovirus infection
    311786 (Traf2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    311786 (Traf2)
   05169 Epstein-Barr virus infection
    311786 (Traf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    311786 (Traf2)
   04121 Ubiquitin system [BR:rno04121]
    311786 (Traf2)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     311786 (Traf2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     311786 (Traf2)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    311786 (Traf2)
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-RING_6 zf-C3HC4_2 zf-C3HC4_4 zf-ACC zf_C2HC_14 PIN_9 MATH
Other DBs
NCBI-GeneID: 311786
NCBI-ProteinID: NP_001101285
RGD: 1310457
Ensembl: ENSRNOG00000006238
UniProt: B5DFH7
Position
3p13
AA seq 497 aa
MAAASVTSPGSLELLQPGFSKTLLGTRLEAKYLCSACRNILRRPFQAQCGHRYCSFCLTS
ILSSGPQNCAACVHEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKE
YESCHEGLCPFLLTECPACKGLVRLSEKKHHTEQECPKRSLSCQHCRAPCSHADLELHYE
VCPKFPLTCDGCGKKISQEKLQDHVRTCSKCRVLCRFHAIGCSELVETEDLQDHELQRLR
EHLALLLSSFLESQASQNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACS
RQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFARK
RQEAIAGRTPAIFSPAFFTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQW
PFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKIEAKNSY
VRDDAIFIKAIVDLTGL
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggctgcagccagtgtgacttcccctggctccctagaactgctgcagcctggcttctcc
aagacccttctggggacaaggttagaagccaagtacctgtgttcagcctgcagaaacatc
ctgcggaggccattccaggcccagtgtgggcaccgctactgctccttctgcctgaccagc
atcctcagctctgggcctcagaactgtgctgcctgtgttcacgaaggcctgtatgaagaa
ggcatttctattttagagagcagttcggcctttccagataacgctgcccgcagagaggtg
gagagcctgccagccgtctgtcccaatgatggatgcacctggaaggggaccttgaaagaa
tacgagagctgccacgaaggactgtgcccattcctgctgactgagtgccctgcgtgtaaa
ggcctggttcgcctcagcgagaagaagcaccacactgagcaggaatgccccaaaaggagc
ctgagctgccagcactgcagggcaccctgtagccatgcagacctggagctacactacgag
gtctgccccaagtttcccttaacctgtgatggctgtggcaagaagatctctcaggagaag
cttcaggaccatgtcagaacgtgcagtaagtgccgggtcctctgcaggttccacgccatc
ggctgctcggagctggtggagactgaggacctgcaggaccacgagctgcagcgtctacgg
gaacatctggccctactgctgagctcgttcctggagtcccaagcctcacagaaccaggtg
gggccagagctgttacagcggtgccagattttggagcagaagatagccacctttgagaac
attgtctgcgttttgaaccgggaggtagagagggtagcagtgactgcagaggcttgtagc
cggcagcaccgtctggaccaggacaagattgaggccctaagcaacaaggtgcagcagctg
gagaggagcatcggcctcaaggacctggccatggctgacctggagcagaaggtctcagag
ttggaggtgtccacctatgatggggtcttcatctggaagatctccgacttcgccagaaaa
cgtcaggaagccatcgctggccggacacctgctatcttctccccagccttcttcacaagc
agatatggctacaagatgtgtctccgggtctacttgaatggcgacggcactgggcgggga
actcatctgtctctcttcttcgtggtgatgaaaggtcccaatgatgctctcttacaatgg
ccttttaatcagaaggtgactttgatgttgctggaccataacaaccgagagcatgtgatc
gacgcattcaggcctgatgtaacttcgtcctccttccagaggcctgtcagtgacatgaat
atcgccagtggctgccccctcttctgcccggtgtccaagatagaggccaagaattcctac
gtgcgggatgacgccatcttcatcaaagctattgtggacctgacaggactctag

DBGET integrated database retrieval system