KEGG   Rattus norvegicus (rat): 311793Help
Entry
311793            CDS       T01003                                 

Gene name
Noxa1
Definition
(RefSeq) NADPH oxidase activator 1
  KO
K21432  NADPH oxidase activator 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    311793 (Noxa1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   NADPH oxidase complex
    311793 (Noxa1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    311793 (Noxa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_1 TPR_2 TPR_1 SH3_9 PB1 SH3_2 TPR_12 TPR_6 TPR_7 TPR_9 TPR_8 TPR_16 DUF4648
Motif
Other DBs
NCBI-GeneID: 311793
NCBI-ProteinID: NP_001093641
RGD: 1306687
Ensembl: ENSRNOG00000009286
UniProt: A7E3N7
Position
3p13
AA seq 446 aa AA seqDB search
MSSLGDQIRDWHRGVLAVAREDWDSALCFFSDVREPLAKMYFNMGCVHLMAGDPEAALRA
FDQAVTKDTCMAVGFLQRGVANFQLQRLQEAVSDFQLALAQLRGNAAIDYTQLGLDFKLQ
AWEVLYNMASVQCQAGLWTKAANTLVEAISKRPEGAQDTLEAAMDKVQKQVPLQLRQVPK
GEVFQPPRRYLKHLEPMDFLGKAKVVASVIPDDHNSDIQPQQSSQVEQAGLQSSSPVCKR
VLSTRGGHMSPGLWDSLLATGGPVPGPSEDSSSAEGTATKDPESLVTVTVQCHFTVPLKV
PRGTDLSSFRTLLSQALLQQTQKGQFSYKARGEDRAWVPISTEDSLQSVWRNVPVSPRGL
QLQCRGAWGRPVLYQVVAQYDYRAQRPEDLDFRQGDTVDVLCEVDEAWLEGHRDGRVGIF
PKCFVVPAATCVEALPVPEPQPGEQH
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgagctctctaggggatcagatacgggactggcaccggggcgtactggccgtagcacgc
gaagactgggactctgcactgtgcttcttttcagatgtccgggagccgctggctaagatg
tacttcaacatgggctgcgtgcacctgatggcaggggatcccgaggctgcgctgagggca
tttgaccaagcagtgaccaaggacacctgcatggctgttggcttcctccagcggggagtg
gccaatttccagctgcagaggctccaggaggctgtgtccgacttccagttggccctggca
cagctgaggggcaatgctgccattgactacacacaactgggtctggacttcaaactgcaa
gcctgggaggtcctatataacatggcatcagtgcagtgccaggcagggctctggaccaag
gctgccaatactctagtagaagcaatctccaaacggccagagggggcccaagacaccctg
gaggctgccatggacaaagtgcagaaacaggtaccactgcagctgcggcaagtgcccaag
ggggaggtcttccagcctcctcggcgatacctgaaacatctggagcccatggatttcctc
ggcaaggctaaggtggtggcttctgtcatccctgatgaccacaactcggacatccagcct
cagcagagctcccaggtggagcaagccggcctccagtcgtcctcacccgtgtgtaagagg
gtcctgagcacaaggggtggtcacatgagccctggcctatgggacagtttgctggcaact
ggagggcctgtcccgggcccctctgaagattcctctagtgctgagggaacagctacaaag
gaccctgaatccttggtgactgtcactgtgcagtgccactttactgtgcccctgaaggtc
cccagaggaactgacctgtccagttttcggacactactgtctcaagctctccttcagcag
acccagaaggggcagttcagctacaaagcccgaggagaggacagagcctgggtccccatc
tccacggaggactcactgcagagtgtatggaggaatgtgccagtgagcccaagaggcttg
cagctccagtgccggggggcctggggccggccagtcctctaccaagtggtagctcagtac
gactatcgtgcccaaaggccggaggacttggacttccgccaaggggacacagtggatgtt
ctgtgtgaagtggacgaagcatggctggagggacaccgagatggccgtgttggtattttc
cccaagtgctttgtagtcccagctgccacctgtgtggaagccctgcctgtacctgaaccc
cagccaggagaacagcactag

DBGET integrated database retrieval system