KEGG   Rattus norvegicus (rat): 311846
Entry
311846            CDS       T01003                                 

Gene name
Lrrc8a, Lrrc8
Definition
(RefSeq) leucine rich repeat containing 8 family, member A
  KO
K22038  volume-regulated anion channel
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    311846 (Lrrc8a)
Ion channels [BR:rno04040]
 Chloride channels
  Chloride channel, volume-regulated (VRAC)
   311846 (Lrrc8a)
SSDB
Motif
Pfam: Pannexin_like LRR_8 LRR_4 LRR_5 LRR_9 LRR_6 BPD_transp_2
Other DBs
NCBI-GeneID: 311846
NCBI-ProteinID: NP_001019953
RGD: 1311690
Ensembl: ENSRNOG00000025296
UniProt: Q4V8I7
Position
3p12
AA seq 810 aa
MIPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDKMICLPCKWV
TKDSCNDSFRGWGASSPEPTYPNSTVLPTPDTGPTGIKYDLDRHQYNYVDAVCYENRLHW
FAKYFPYLVLLHTLIFLACSNFWFKFPRTSSKLEHFVSILLKCFDSPWTTRALSETVVEE
SDPKPAFSKMNGSMDKKSSTVSEDVEATVPMLQRTKSRIEQGIVDRSETGVLDKKEGEQA
KALFEKVKKFRTHVEEGDIVYRLYMRQTIIKVIKFFLIICYTVYYVHNIKFDVDCTVDIE
SLTGYRTYRCAHPLATLFKILASFYISLVIFYGLICMYTLWWMLRRSLKKYSFESIREES
SYSDIPDVKNDFAFMLHLIDQYDPLYSKRFAVFLSEVSENKLRQLNLNNEWTLDKLRQRL
TKNAQDKLELHLFMLSGIPDTVFDLLELEVLKLELIPDVTIPPSIAQLTGLKELWLYHTA
AKIEAPALAFLRENLRALHIKFTDIKEIPLWIYSLKTLEELHLTGNLSAENNRYIVIDGL
RELKRLKVLRLKSNLSKLPQVVTDVGVHLQKLSINNEGTKLIVLNSLKKMVNLTELELIR
CDLERIPHSIFSLHNLQEIDLKDNNLKTIEEIISFQHLHRLTCLKLWYNHIAYIPIQIGN
LTNLERLYLNRNKIEKIPTQLFYCRKLRYLDLSHNNLTLLPADIGLLQNLQNLAVTANRI
EALPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLPVELGECPLLK
RSGLVVEEDLFSTLPPEVKERLWRADKEQA
NT seq 2433 nt   +upstreamnt  +downstreamnt
atgattccggtgacagagctccgctacttcgcggacacgcagccagcataccggatcctg
aagccgtggtgggatgtgttcactgactacatctccattgtcatgctgatgattgctgtc
tttggggggacactgcaagtcacccaggacaagatgatctgcctaccttgtaagtgggtc
accaaagactcctgcaacgactccttccggggctggggggcctccagcccagagcccact
taccccaactccacagtcctgcctactcctgacacgggccccacaggtatcaagtatgac
ctagatcgccaccagtacaactacgtggatgccgtgtgttacgagaaccgcctgcattgg
tttgccaagtacttcccctacctcgtgctcctgcacaccctcatcttcctggcctgcagc
aacttctggttcaagttcccacgcaccagctcgaagctggagcacttcgtgtctatcctg
ctcaagtgctttgattcgccatggaccacacgggccctgtcagagacagtagtggaggag
agtgaccccaagccagccttcagcaagatgaatggctccatggacaagaagtcatccacg
gtcagtgaggatgtggaggccactgtgcccatgctgcagcggaccaagtcacggattgag
cagggcatcgtggaccgctccgagacaggtgtgctggacaagaaggaaggggagcaggcg
aaggcactgtttgagaaggtgaagaagttccggacccatgtggaggagggggacatcgtg
taccgcctctacatgcggcagaccatcatcaaggtgatcaagttcttcctcatcatctgc
tacaccgtgtactatgtgcacaacatcaagtttgacgtggactgcaccgtggacatcgag
agcctgacaggctaccgcacctaccgctgtgcccaccctctggccaccctcttcaagatc
ctggcatccttctacatcagcctggtcatcttctacggcctcatctgcatgtacaccctg
tggtggatgctccggcgctccctcaagaagtactcgtttgagtcgatccgagaggagagc
agctacagcgacatcccagacgtcaagaatgacttcgccttcatgttgcacctcattgac
cagtatgaccctctctactcaaagcgcttcgccgtcttcctgtctgaggtgagtgagaac
aagctgcgtcagctgaacctcaacaacgagtggacgctggacaagctgcgccagcggctc
accaaaaacgcccaggacaagctggagctgcacctcttcatgctgagcggcatcccggac
accgtgtttgacctgctggagttagaggtcctgaagctggaactgatccccgacgtgacc
atcccgcccagcatcgcccagctcacaggcctcaaggagctctggctgtaccacacggca
gccaagatcgaggctcccgccctggccttcctgcgagagaacctgcgggcgctgcacatc
aagttcactgacatcaaggagatcccactgtggatctacagcctgaagacactggaggag
ctgcacttgacaggcaacctgagcgcagagaacaaccgctacatcgtcattgacggactg
cgggagctcaaacgccttaaggtgctgcggctcaaaagcaacctgagcaagctgccgcag
gtggtcacggacgtgggcgtgcacctgcagaagctgtccatcaacaatgagggcaccaag
ctcatcgtcctcaacagcctcaagaagatggttaacctgacagagctggagctgatccgc
tgcgacctggagcgtatccctcactccatctttagcctccacaacctgcaggagatcgac
ctgaaggacaacaacctcaagaccatcgaggagatcatcagcttccagcatctgcaccgc
ctcacctgccttaagctgtggtacaaccacatcgcctacatccccatccagatcggcaac
ctcaccaaccttgagcgcctctacctgaaccgcaacaaaatcgagaaaattcccacccag
ctcttctactgccgcaagctgcgctacctggacctcagccacaacaacctgaccttgctc
cccgctgacattggcctcttgcagaacctccagaacctggccgtcacagccaataggatc
gaggcgctccccccggagctcttccagtgtcggaagctgcgggctctacacctgggcaac
aatgttctgcagtcactgccctcgagagtgggtgagctgaccaacctgacgcagattgag
cttcggggcaaccggctggagtgcctgcccgtggagctgggcgagtgtcccctgctcaag
cgcagcggcctggtggtagaggaggacttgttcagcacactgccgcctgaggtgaaggaa
cggctctggagagctgacaaggagcaggcctga

DBGET integrated database retrieval system