KEGG   Rattus norvegicus (rat): 311952Help
Entry
311952            CDS       T01003                                 

Gene name
Galnt11
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 11
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00512  Mucin type O-glycan biosynthesis
rno01100  Metabolic pathways
Module
rno_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    311952 (Galnt11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    311952 (Galnt11)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     311952 (Galnt11)
Glycosyltransferases [BR:rno01003]
 O-Glycan biosynthesis
  Mucin-type
   311952 (Galnt11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 RicinB_lectin_2 Glyco_transf_7C Glyco_tranf_2_2
Motif
Other DBs
NCBI-GeneID: 311952
NCBI-ProteinID: NP_955425
RGD: 735097
Ensembl: ENSRNOG00000008117
UniProt: Q6P6V1 A0A0G2K7K0
Position
4q11
AA seq 609 aa AA seqDB search
MMGSVTIRYFCYGCLFTSATWTVLLFIYFNFSEVTQPLRNVPIKGSGPHGPFPKKFYPRF
TRGPGRVLEPQFKANRMDDLMNNNIEDPDKGLSKSSSELGMIFNERDQELRDLGYQKHAF
NMLISNRLGYHRDVPDTRNAECRGKSYPTDLPTASVVICFYNEAFSALLRTVHSVVDRTP
AHLLHEIILVDDSSDFDDLKGELDEYIQRYLPAKVKVIRNMKREGLIRGRMIGAAHATGE
VLVFLDSHCEVNVMWLQPLLAIILEDPHTVVCPVIDIISADTLAYSSSPVVRGGFNWGLH
FKWDLVPVSDLGGADSATAPIRSPTMAGGLFAMNRQYFNDLGQYDSGMDIWGGENLEISF
RIWMCGGKLFIIPCSRVGHIFRKRRPYGSPEGQDTMTHNSLRLAHVWLDEYKEQYFSLRP
DLKTKSFGNISERVELRKKLGCQSFKWYLDNVYPEMQVSGPKARLQQPVFINRGPKRPRV
LLRGRLYHLQTNKCLVAQGRSSQKGGLVLLKACDYGDPTQVWIYNEEHELILNNLLCLDM
SETRSSDPPRLMKCHGSGGSQQWTFGKNNRLYQVSVGQCLRVVDQMDQKGYVGMAICDGS
SSQQWRLEG
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgatgggcagtgtcacaattcgatatttctgctacgggtgcctctttacatctgctacc
tggacagttctgcttttcatttattttaacttcagtgaagtgactcagccccttaggaat
gtgcccatcaaggggtctgggccccatgggccgtttcccaaaaaattctacccacgtttc
actcgaggtccaggccgagtattagagccacagttcaaagcaaacagaatggacgatttg
atgaataataacattgaagatccagataaaggcctctcaaaatcttcctctgagctaggt
atgattttcaatgaacgtgatcaggaattgagagacctgggctaccagaaacacgccttt
aatatgctcattagtaaccgcttggggtaccacagagacgtgccagacaccaggaatgca
gagtgtagggggaagtcctacccaactgacctgccaactgctagcgttgttatctgtttc
tacaacgaagctttttctgccttgttgcggactgtgcacagtgttgtggaccgcacgccg
gcacaccttctccatgagatcatcctcgtggatgacagcagtgactttgatgatttaaaa
ggagaactagatgagtacatccaaagatacctgcccgcaaaggtcaaggtcataagaaat
atgaagcgagagggactgatccgaggaagaatgattggagcagcccacgctacaggagaa
gtcctggtcttcctggacagccactgcgaagtgaatgtgatgtggttacagccccttctg
gccatcatccttgaagacccacatacagtggtgtgccctgtgattgacatcatcagtgct
gacacactcgcttacagttcatccccagtggttcggggaggtttcaactgggggctgcac
ttcaagtgggatctagttcctgtatctgacctgggaggcgcagacagtgccacagcccca
atacggtcacctacaatggccggaggactgtttgccatgaacagacagtatttcaatgat
cttggacagtatgacagtggcatggatatctggggaggagaaaatctggaaatctcattt
cggatctggatgtgcggcggcaagctcttcatcatcccttgctcaagagtcgggcacatt
tttcggaaaaggcgaccgtatggatctcctgaaggccaggacaccatgacacacaactcg
ctgagactggcacatgtgtggctggatgagtacaaggagcagtatttttccttaagacct
gatttgaagaccaaaagctttgggaatatcagcgagcgtgttgaattgaggaagaaactg
ggctgtcagtcgttcaagtggtatttggataatgtttaccctgagatgcaggtgtctggt
ccgaaggccagactgcagcagcccgtgttcatcaacagaggaccgaagcgccccagagtc
ctgctgcgtggaaggctctaccacttgcagaccaacaaatgcctggtggcccagggccgc
tccagccagaaaggaggcctggtgctgcttaaggcctgtgactacggagacccaactcag
gtctggatttacaacgaagagcatgaattgatcttaaacaacctcctttgcctcgacatg
tcagaaacccgctcgtcagaccctcctcgactcatgaagtgccacgggtcaggagggtcg
cagcagtggacctttgggaagaacaatcggctgtaccaagtgtcggttgggcagtgcctg
agagttgtggaccagatggatcagaagggctacgtcggcatggcgatctgtgatggctcc
tcttcccaacagtggcgcctagaaggctaa

DBGET integrated database retrieval system