KEGG   Rattus norvegicus (rat): 311984
Entry
311984            CDS       T01003                                 

Gene name
Gsap, Pion
Definition
(RefSeq) gamma-secretase activating protein
Organism
rno  Rattus norvegicus (rat)
SSDB
Other DBs
NCBI-GeneID: 311984
NCBI-ProteinID: NP_001101315
RGD: 1563271
Ensembl: ENSRNOG00000028801
UniProt: D3ZPQ9
Position
4q11
AA seq 622 aa
MALRLVTHFDVLADVLPSLLVQAATADEGDEGAETTLGSLRVLNIERNGDIIYTYKDNKG
NAVFGIFDCQTRENEHLYTFEKDMQAVSCSVNSERTVLAASFIQYTEGVRSELQPGSKCL
TLLVEIHPVNNVTVLKAVDSCVWVQFLYPQAESHLLAQNHLLLISEEKYIERFHIQITRE
DGNRVVIRNSSHLPRERIAEDFVWAQWDVSEQRIHYIELQESRSILKCVQFWADESFTIM
FEMPLDISLSGLRFKLVNFGYDYRQDQAKLCHQPSLCIFTNHTGSLCVCYSPKSDSWKEI
TYSVFYLHKGYFVAVYSPCRFLHLLNIRHPDLICHSLFLTGNNKTAAVLPPSPLQSLPGS
LILDCSSGKVYRATLDQSYLMGFLWNAQLDCEKMAALHCALSCDSDPGFPEQIVQWVSER
VSACHSFDLIQEFLIASSYWSVYPGLDDVDLLLPYSSVLTWDTEIPGMKLVTEELPLPLM
KVYSLKGYWAKLNSNLEYIKYTKPHLHYHNSVVRREWHNLISEERTGKRRSTMYVRNILD
NAVKVISNMEMKTFEPRLIPLLQEEDRHQRLLMGLMVSELRDHLLRHLQGVEKKKIEQMV
LDYISKLVGFTFSSNFNCLLSP
NT seq 1869 nt   +upstreamnt  +downstreamnt
atggctctgcggctggtcacccacttcgacgtgctggcggacgtgctcccgagtctgctc
gtccaggcagcgacagcagatgaaggagacgaaggcgcagaaacaactcttgggagctta
cgtgtactaaacatcgaaagaaatggagacattatttatacctataaggacaacaaagga
aatgcggtcttcggaatatttgactgccaaaccagagaaaatgagcatctgtacaccttc
gagaaggacatgcaagctgtcagttgctcagtcaacagcgagaggacagtgcttgctgca
agcttcattcagtacacggaaggagtaaggagtgagcttcagccaggatcgaagtgtcta
actttgctggttgaaatccaccctgtcaacaacgtgacggttctgaaagctgtggatagc
tgcgtttgggtacagttcctctacccacaagctgaaagtcatcttcttgcacagaaccac
ctgttactgatttcagaagagaaatatattgaacggtttcatatccagatcaccagagaa
gatggaaacagagtggtaattagaaattctagccatctcccaagagaaagaatagctgaa
gacttcgtttgggctcagtgggatgtgtcagagcagagaatccactacattgaactgcag
gagtcaaggagtatcttgaaatgcgtccagttctgggcagatgaaagctttaccataatg
tttgaaatgcccttggacatatcattaagtggcttgagatttaaactcgtcaacttcggc
tatgattatcgtcaagaccaagccaagctttgccatcagccatccctctgcatttttacc
aaccacacagggagtttgtgtgtgtgttacagcccgaagtctgactcttggaaagaaatc
acgtattcagtgttttacctccataaaggctactttgtggctgtttattccccctgccgt
ttccttcatttacttaacattcggcatccagacttgatctgccacagtctgtttctcaca
ggaaacaacaaaacggccgctgtgctacctccgagtcctttgcagtccctgccggggtcc
ctcattctggactgctcttctggaaaggtctatagagcaactcttgaccagtcatacttg
atgggtttcctgtggaacgcccagctagactgtgagaaaatggctgcgctgcattgtgca
ctgtcctgtgattcagacccaggtttcccagaacagatcgttcagtgggtttctgagcgt
gtctctgcctgccattcatttgacctcattcaagaattcctaattgcgtcctcctattgg
agtgtgtatccagggctggatgacgtggacctgctcttaccctactcctctgtgctgaca
tgggacacagaaattcctggaatgaagcttgtgacagaagagctcccgttacctcttatg
aaggtctacagcttgaaggggtactgggcaaagctgaactccaacctcgagtatattaag
tacaccaagcctcacctgcactaccacaacagcgtcgtgaggagagagtggcataacctg
atctctgaagagagaacgggaaaaaggaggtccacaatgtacgtgaggaacattcttgac
aacgctgtgaaggtgatttctaacatggaaatgaaaacattcgagccaaggttaataccc
ctcttacaagaggaagacaggcaccagaggctgctcatgggcctgatggtgtctgagcta
agagaccatctactgagacacctgcagggtgtagaaaagaagaaaattgaacagatggtt
ctggactacatttcaaaactggttggttttactttttcttctaatttcaactgtctcctt
agcccatga

DBGET integrated database retrieval system