KEGG   Rattus norvegicus (rat): 312083
Entry
312083            CDS       T01003                                 

Gene name
Vps50, Ccdc132, RGD1304751
Definition
(RefSeq) VPS50 EARP/GARPII complex subunit
  KO
K23288  syndetin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    312083 (Vps50)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Others
   EARP complex
    312083 (Vps50)
SSDB
Motif
Pfam: Vps54_N DUF2451
Other DBs
NCBI-GeneID: 312083
NCBI-ProteinID: NP_001166982
RGD: 1304751
Ensembl: ENSRNOG00000009894
UniProt: F1LSG8
Position
4q13
AA seq 964 aa
MQKIKSLMTRQGLKSPPESLNDLGAFESLRVPGKEEFRELREQPSDPQAEQELINSIEQV
YFSADPFDIVKYELEKLPPVLNLQELEEYRDKLKQQQAAVSKKVADLILEKQPAYVKELE
RVTSLQTGLQLAAVICTNSRRHLNIAKEGFTQASLGLLANQRKRQLLIGLLKSLRTIKTL
QRTDVRLSEMLEEEDYPGAIQLCLECQKAASTFKHYSCISELNSKLQDTLEQIEEQLDVA
LSKICKNFDVNHYTKVQQAYRLLGKTQTAMDQLHMHFTQAIHNTVFQVVLGYVELCAGNT
DTKFQKLQYKDLCTHVTPDSYIPCLADLCKALWEVMLSYYRTMEWHEKHDSEETAAASEG
SNVMSTEETNFDRGYVKKKLEHGLTRIWQDVQLKVKTYLLGTDLSIFKYDDFIFVLDIVS
RLMQVGEEFCGSKSEVLQESIRKQSINYFKNHHRIRLDELRMFLENETWELCPVKSNFSI
LQLHEFKFLEQSRSPSVSPSKQPSATSSKPVTLFEQYCSGGNPFEIQADHKDEETEDVLA
SNGYESDEQEKSAYQDYDSDSDVPEELKRDYVDEQTGDVPVKSVSRETLKSRKKSDYSLN
KVNAPILTNTTLNVIRLVGKYMQMMNILKPIAFDVIHFMSQLFDYYLYAIYTFFGRNDSL
ESTGLGLSSSRLRTTLNRIQESLIDLEGSADPTATLTAAEERKEKVPSPHLNQLVILTSG
DTLYGLAERVVATESLVFLAEQFEFLQPHLDAVMPAVKKPFLQQFYSQTVSTASELRKPI
YWIVAGKAIDYEQMLLLMTNVKWDVKEIMSQHNVYVDALLKEFEQFNKRLNEVSKRVRIP
LPVSNILWEHCIRLANRTIVEGYANVKKCSNEGRALMQLDFQQFLMKLEKLTDIRPIPDK
EFVEIYIKAYYLTENDMERWIKEHREYSTKQLTNLVNVCLGSHINKKARQKLLAAIDDID
RPKR
NT seq 2895 nt   +upstreamnt  +downstreamnt
atgcaaaaaatcaaatctcttatgacccggcagggtctgaagagccctccggagagcctc
aatgatctgggtgcctttgagagccttcgggtccctggaaaggaggaattcagggaactt
cgagagcagccaagcgaccctcaagctgaacaagagctaattaatagtattgaacaagtt
tatttttctgcggatccatttgatattgttaaatatgagctggagaagcttcctcctgtt
ctcaatctgcaagagctagaggagtacagagacaaattaaagcaacagcaagctgcagtc
tctaaaaaagtggcagatttgattcttgagaaacagcctgcttatgtaaaggagcttgag
agagttacatcgctgcagacaggtcttcagttggctgctgttatctgcacaaacagcagg
agacacttgaatattgcgaaggaaggttttactcaggctagcttaggccttcttgcaaat
caaaggaaacgtcagttgctgattggacttctgaagtcactgagaaccattaaaacattg
caaagaaccgatgtacgcttaagtgaaatgctggaggaagaggactatccaggagctatt
cagctgtgcctggaatgtcagaaggctgccagcacttttaaacactacagctgtataagt
gagctgaattcaaagctgcaggatactttggagcaaattgaggaacagttggatgtagct
ctttccaagatctgcaagaattttgacgttaaccattacaccaaggttcagcaagcttat
cggcttcttggaaaaacacagactgcaatggatcagcttcatatgcacttcactcaagcc
attcacaacaccgtgtttcaagttgtgcttggctatgtggagctgtgtgcaggaaacaca
gatacaaagttccagaagcttcagtataaagatctctgtacgcacgttacaccagacagc
tatattccatgcctggcggacctgtgcaaagcactgtgggaagtcatgctgagctactac
agaaccatggagtggcatgagaaacacgacagtgaggaaacagctgcagcttctgaagga
agtaatgtgatgagtactgaagaaaccaattttgatcgtggctatgtaaaaaagaaatta
gagcatggccttacgcgaatatggcaggatgttcaactaaaagtaaaaacctacttgctt
ggaactgatttatctattttcaaatatgatgatttcatctttgttctggatatagtcagc
aggttgatgcaagttggagaagagttttgtggtagcaagtctgaagttttgcaggaatcc
attagaaaacaaagtatcaattacttcaagaaccaccataggataagacttgatgaactg
agaatgttcttagagaatgagacatgggagctttgccctgttaagtcaaatttcagcatc
ttgcagcttcatgagtttaaattcctggaacagtctcgatccccatcagtttcacctagt
aagcagccatcggcaacttcttccaaacctgtgactttgtttgagcagtactgcagtggt
gggaatccatttgaaattcaagctgaccacaaagacgaagaaacagaagatgtcttagcc
tctaatgggtacgaatctgatgagcaagagaagagtgcctatcaggactatgacagcgac
agcgacgttcctgaggagctgaagcgcgattatgtagatgagcaaaccggcgatgtgccc
gtaaagagtgtttcacgagagacactgaagagcaggaagaaatcggattacagtctaaat
aaagtgaatgcacccatcttaacaaacacaaccttgaatgtcataaggcttgttggaaag
tacatgcagatgatgaacatccttaagccaatcgcctttgatgttatccatttcatgtct
cagctctttgattattacttgtatgccatatacaccttttttggtcggaatgattcattg
gaatcaacaggacttggccttagtagtagcagactaagaacaactctaaacagaattcag
gaaagccttattgacctggagggctcagctgatcctactgccactctcacagcagccgag
gaaagaaaggagaaggtacccagcccacacctcaatcagctagtgattttgacatctggg
gatacattgtatgggttggcagagagagtggtagccacagaatccttagtgttcttggct
gagcagttcgagttccttcaaccacatttggatgctgtgatgcctgcagtcaaaaagccc
ttcctgcagcagttttactcccagacagtctcaactgccagtgaactgcgcaaacccatt
tactggattgtggctggtaaagctattgattatgaacagatgcttctcctaatgacaaat
gtgaagtgggatgtcaaagagatcatgtcacagcacaacgtctatgtagatgcattgcta
aaggaatttgaacagtttaacaagcggttaaatgaagtttctaagagagttcggataccc
ttgcctgtatcaaatatactttgggaacattgtatacgattagctaacagaactattgtg
gaagggtacgccaatgtcaagaagtgcagtaatgagggacgtgccttgatgcaattggat
tttcaacagtttttaatgaaactcgagaaactaactgacattaggcctattcctgataaa
gaatttgtggaaatatatatcaaagcctactacctgactgagaatgacatggagcgttgg
atcaaagagcaccgggaatattcaacgaagcagttgaccaacctggtgaatgtttgcctg
ggatctcatattaataagaaagcaagacagaagctcctagcagctatagatgatatagac
agacctaaacgataa

DBGET integrated database retrieval system