KEGG   Rattus norvegicus (rat): 312102Help
Entry
312102            CDS       T01003                                 

Gene name
Vsig4
Definition
(RefSeq) V-set and immunoglobulin domain containing 4
  KO
K19822  V-set and immunoglobulin domain-containing protein 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    312102 (Vsig4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 ig I-set DUF5305 Stevor FixH
Motif
Other DBs
NCBI-GeneID: 312102
NCBI-ProteinID: NP_001020175
RGD: 1564659
Ensembl: ENSRNOG00000038132
Vega: OTTRNOG00000000530
UniProt: F7FEU1
Position
Xq22
AA seq 285 aa AA seqDB search
MEISSSLLFLSHLIVLTYGHPVLKTPERVTGTWKGDVKIQCIYNPLTGYREVLVKWLVQR
GSDHVTIFLRDYSGDHVQQAKYRGRLKVSHKVPGDVSLQLNNLQMDDRNHYTCEVTWQTP
DGDQVRRDKITELRVQKYPYKPPKITTEALTTMQSSLEATTITSSTSDWTTSVTQTPQGT
TTVPGGKLPIFAIILIICFCCIVVVTIAFIMFRRRTFQEYVYEVSRMYARQTSNSEETTR
VTTIASAYFNNEPDSQALINDYSDDPCLSQEYQITTRSTMTIPAC
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggagatctcatcgagcttgctgttcctgagccacctaatagtgctcacctatggccat
cccgtcctaaaaacaccagagcgtgtgacaggaacctggaaaggagatgtgaagattcag
tgcatctataatcccctgacaggctacagagaagttttggtgaaatggctggtacaacgt
ggctctgaccatgtcaccatcttcttacgtgactactctggagaccatgtccagcaggca
aaatacagaggccgcctgaaagtgagccacaaagttccaggggatgtgtctctccaactg
aataaccttcagatggatgacaggaatcactacacatgtgaggtcacctggcagactcct
gatggagaccaagtaaggagagataagatcactgagctccgtgttcagaaatacccgtat
aagccacctaaaatcactactgaagcacttacgaccatgcaatcctctttggaagcaacg
actataacgagttcaacttctgactggaccactagtgtgactcaaacacctcaggggacc
actactgtcccaggagggaagctgccgatctttgccataatcttgatcatctgcttttgc
tgcatagtagttgtcaccatagcttttatcatgttccgccgcagaacattccaagagtat
gtctatgaggtgagcaggatgtatgccagacagacaagcaactctgaagaaaccacaaga
gtgactaccattgcaagtgcatacttcaataatgaaccagattcccaggctctgatcaat
gactactctgatgatccttgtctcagccaggagtaccaaataacaaccagatcaacaatg
actattcctgcctgctga

DBGET integrated database retrieval system