KEGG   Rattus norvegicus (rat): 312113Help
Entry
312113            CDS       T01003                                 

Gene name
Stard8, RGD1560770
Definition
(RefSeq) StAR-related lipid transfer domain containing 8
  KO
K20632  deleted in liver cancer protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    312113 (Stard8)
Membrane trafficking [BR:rno04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    312113 (Stard8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: START RhoGAP ARA70
Motif
Other DBs
NCBI-GeneID: 312113
NCBI-ProteinID: NP_001101319
RGD: 1560770
Ensembl: ENSRNOG00000033883
Vega: OTTRNOG00000000564
UniProt: D4A5B9
Position
Xq22
AA seq 1014 aa AA seqDB search
MTLNNCASMKLEVHFRCKQDDDSEEEEQCTISSHWAFEQESKCGSLTGSSALLAPPSPSL
PGTSSCESVLTELSAASLPAISVSLSPESADLPLLGHVPSPSNQPFLSPTQGQEGSQDKV
KKHYSRSFLKHLESLRRKEKGDSRQTEPEQRLATSEKATKASSFRTCRGLLSVGFHRAKN
RVTTSPRVRDGETQKTWEAWPVATFRHPQPNRRHDCLVHVPRDHKPGTFPRSLSIESLCP
DDSRHLADWQPNRCWGYEGRRGSCGSTGSHASTYDNLPELYPAEPIQAEAEDEDEEGEGS
YAHLDDILEHVWGLQQRVELWSQAMYPDLRPGDKEEEEEEEEEATSSVEIATAEVEGQDE
ALAQAESQVHRGFPTEVKEEVPLIVLDQAPTVVEPLVQAEAPAQAQHPEQDANSAAEPIS
ASSLSVEEGHSISDTAVSSSELDSSGNSVNEADVADALAGPNASVPRERRDSGVGASLTR
PCRKLRWHSFQNSHRPSLNSESLEINRQFAGQINLLHKGSLLRLTGFMEKYTVPHKQAWV
WSMPKFMKRNKTPDYRGHHVFGVPPLIHVQRTGQPLPQSIQQAMRYLRSQCLDQVGIFRK
SGVKSRIQSLRQMNETSPDNVCYEGQSAYDVADLLKQYFRDLPEPIFTSKLTTTFLQIYQ
LLPKEQWLAAAQAATLLLPDENREVLQTLLYFLSDIASAEENQMTAGNLAVCLAPSIFHL
NVSKKDSPSPRIKSKRSLVGRPGPRDLSENMAATQGLSHMISDCKKLFQVPQDMVVQLCG
SYSAAELTPPGPALAELRQAQAAGVSLSLYMEESVQELLRDAAERFKGWTNVPGPQHTEL
ACRKAPDGHPLRMWKASTEVAAPPAVVLHRVLRERALWDEDLLRAQVLEALMPGVELYHY
VTDSMAPHPCRDFVVLRMWRSDLPRGGCLLVSQSLDPEQPVPESGVRALMLTSQYLMEPC
GLGRSRLTHICRADLRGRSPDWYNKVFGHLCAMEVAKIRDSFPTLQAAGPETKL
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgaacaattgtgcttcgatgaagctcgaggttcattttcgatgcaagcaggat
gacgactcagaagaggaggagcaatgcaccatcagcagccactgggcctttgagcaggaa
agcaagtgtgggtctctcacgggctcttctgccctgctggccccaccaagccctagcctc
ccggggacctcaagctgtgaaagtgtcctcaccgagcttagcgctgcctctctgccagcc
atctccgtgagcctttcgccagagtcagcagacctgcccttgttaggtcatgtccccagc
ccaagtaaccagcccttccttagtcccacccagggccaggagggttcccaagacaaagtg
aagaagcattattccagaagcttcctcaagcacctcgaatctctgaggaggaaggaaaag
ggtgacagccggcaaacagaacctgagcaacgcttagccacctcagaaaaggccactaaa
gcctcatctttccgcacttgccgtggcctcctctcagttggatttcacagggccaagaac
agggtcaccacttcacccagggtcagagatggtgagactcagaaaacctgggaggcttgg
cctgtagccacattccggcatcctcagcctaatcgcaggcatgactgcctggtgcatgtg
cctagggaccataagccaggcacattccctcgttctctgtccattgaaagcctttgtcca
gatgatagtcgtcacctggcagattggcagccaaataggtgctggggctatgaagggcgc
cggggctcctgtggttctaccggcagccatgccagcacttacgacaacttgcctgagctg
tacccagctgagcctatacaggctgaggctgaagatgaagatgaggagggtgaaggcagc
tatgcccatctagatgacatcctagagcatgtgtgggggctacagcaacgggtagagctg
tggtctcaggccatgtacccagacttgaggcctggagataaggaggaggaagaggaggag
gaagaggaagctacttcatcagtggaaatagccacagctgaggtggaaggccaggatgaa
gctctagcccaggcagagtcccaagtccacagaggtttcccaactgaagtcaaggaggaa
gtcccactgatagtcctggatcaggccccgactgtggttgaaccattggtacaggctgag
gctccagcccaggcccagcatcctgagcaagacgcaaattcagccgcagagcctatttct
gcctccagcctgtccgtggaggaagggcattccatttctgacacagcggtatcctccagt
gaacttgacagtagtggcaactccgtgaatgaggcagatgttgcagacgccctggcggga
cctaacgcatcagtaccccgtgaacggcgtgactcgggtgtcggggcctcacttaccaga
ccatgcaggaaacttcgttggcacagcttccagaattcccaccgacctagtctcaactca
gagtcactggagatcaacaggcagtttgcaggccagatcaacttgcttcacaagggctct
ctgctgcggctcactggcttcatggaaaagtacactgtgccccacaaacaagcctgggta
tggtcaatgcccaagtttatgaaaagaaacaaaaccccagactaccggggacaccatgta
tttggagtgccacccctcattcatgtccagcgtacaggccaacccttgccccagagcatt
cagcaagctatgcgctacctacgaagccagtgcctagaccaggtgggcatctttcgcaag
tctggggtcaagtccaggattcagagcctacgccaaatgaatgagacatcccctgacaac
gtctgctatgagggccagtcggcctacgatgtggctgatttactgaagcagtatttccga
gacctgcctgagcccatttttaccagcaagctcaccaccactttcctacaaatctaccag
ctcctccccaaagaacagtggttggcagcggcacaagctgccaccttgctgctccctgac
gagaaccgagaagtgctacagaccctgctctatttcctaagtgacattgcctctgctgag
gaaaaccagatgacagctggcaacctggcagtgtgcctggcaccctctatcttccacctc
aatgtctccaagaaggacagcccctcacccaggatcaagagcaaacgaagcctggttggc
cggccaggccccagggacttgagtgagaacatggctgccacacaaggtctatcacacatg
atcagtgactgcaagaaacttttccaggtaccccaggatatggtggtgcaactatgtggt
tcatacagtgcagctgagctcacccctcctgggccagccctggctgagctaaggcaagca
caggctgctggggtgagtctgagcctttacatggaggagagtgtgcaggagttgctccgg
gatgctgcagaacgcttcaagggatggaccaatgtgccggggccccagcacacagagctg
gcttgcaggaaggcaccagatgggcaccctcttcggatgtggaaggcatccacagaagtg
gctgcccctccagctgtggtgctgcatcgtgtccttcgggagcgggccctgtgggatgag
gacctactgcgggcccaggtgctggaagccctgatgccaggtgtggaactgtaccactat
gtcactgacagcatggcaccccatccttgccgtgactttgtggtgctcaggatgtggcgc
tcagacctgcctcgtggtgggtgcctccttgtctctcagtccctggatcctgagcaaccc
gtgccagagtctggagtacgcgccctcatgctcacttcccagtacctcatggaaccctgt
ggcctgggccgctctcgcctcactcatatttgccgcgctgacctcaggggccgttctcct
gactggtacaacaaagtctttgggcacttgtgtgccatggaagtggcaaagatccgagac
tccttcccaacacttcaggcagctggccctgaaacaaagctatga

DBGET integrated database retrieval system