KEGG   Rattus norvegicus (rat): 312195
Entry
312195            CDS       T01003                                 

Gene name
Nrf1
Definition
(RefSeq) nuclear respiratory factor 1
  KO
K11831  nuclear respiratory factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04371  Apelin signaling pathway
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    312195 (Nrf1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    312195 (Nrf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    312195 (Nrf1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Nuclear respiratory factors
    312195 (Nrf1)
SSDB
Motif
Pfam: Nrf1_DNA-bind YchF-GTPase_C TGS DUF5008 DUF3459 Peptidase_M23
Other DBs
NCBI-GeneID: 312195
NCBI-ProteinID: NP_001094178
RGD: 1304603
Ensembl: ENSRNOG00000008752
UniProt: B1WC04
Position
4
AA seq 534 aa
MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPEDTSYDDSDILN
STAADEVTAHLAAAGPVGMAAAAAVATGKKRKRPHVFESNPSIRKRQQTRLLRKLRATLD
EYTTRVGQQAIVLCISPSKPNPVFKVFGAAPLENVVRKYKSMILEDLESALAEHAPAPQE
VNSELPPLTIDGIPVSVDKMTQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPW
ANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQQTQTQATTTHSIAHL
VPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSAVADGEVEQNW
ATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSEAAAHAVATLAE
ATLQGGGQIVLSGETAAAVGALTGVQDANGPDGVHAWTISKAVTAPQAAGKIHTDFGKGF
IMAEVMKDEDLKEESSENAAKAAGKYKQPGRAYVVEDGDIIFFKFNSPQQLKRK
NT seq 1605 nt   +upstreamnt  +downstreamnt
atggaggaacacggagtgacccaaaccgaacacatggctaccatagaagcccatgcagtg
gcccagcaagttcagcaggtccatgtagccacttacactgagcacagtatgctaagtgct
gatgaagactccccttcctcgcctgaggacacttcttacgatgactcggacatactcaac
tccacggcagctgatgaggtaactgcccatctggctgctgcaggtcctgtgggaatggct
gctgctgctgctgtggcaacagggaagaaacggaaaaggcctcatgtgtttgagtctaac
ccatctatccgaaagagacagcagacacggttgcttcggaaactcagagccacattagat
gaatatacgacacgagtgggacagcaagccattgttctctgcatctcaccctccaaaccc
aaccctgtctttaaggtgtttggcgcagcacctttggagaatgtggtgcgcaagtacaag
agcatgatcctggaagacctggagtctgcgctggcagagcacgcccctgcgccacaggag
gttaattcagaactgccccctctcaccatcgatgggattccagtctctgtggacaagatg
acccaggctcagcttcgggcatttatcccagagatgctcaagtactccacaggtcgggga
aaaccaggctgggggaaagaaagctgcaagcctatctggtggccagaagacatcccatgg
gccaatgtccgcagtgacgtccgcacagaagagcaaaagcaaagggtttcatggacccaa
gcattacggaccatagttaaaaattgttataagcagcatgggcgggaggaccttctgtat
gctttcgaagatcagcagacacaaactcaggccaccaccacacacagcatagcccatctc
gtaccatcacagacagtagtacagaccttcagcaaccctgatggcaccgtgtcgctcatc
caggttggtactggggcaacagtagccacattggctgatgcttcagaactgccaaccaca
gtcactgttgcccaagtgaattattctgctgtggctgatggagaggtggaacaaaattgg
gccacattacagggcggtgaaatgaccatccagacgacgcaagcatcagaggccacccag
gcagtggcatcactggcagaggccgcagtggccgcttctcaggagatgcaacagggagcc
actgtcaccatggcccttaacagtgaagctgccgcccatgctgtcgccactctggctgaa
gccaccttacaaggcgggggacagatagtcctgtctggggaaaccgcagcagccgttgga
gcacttactggagtccaagatgctaatggcccagatggagttcatgcatggaccatcagc
aaagccgtgacggctcctcaggctgcaggaaaaattcatacagattttggaaagggattc
attatggcggaagtaatgaaagacgaagatcttaaagaggagagttctgagaacgcagct
aaggctgctgggaagtacaaacaaccaggcagagcttacgttgttgaagacggagatatt
atcttcttcaaatttaactcgccacagcaactgaaaaggaaataa

DBGET integrated database retrieval system