KEGG   Rattus norvegicus (rat): 312203Help
Entry
312203            CDS       T01003                                 

Gene name
Klf14
Definition
(RefSeq) Kruppel-like factor 14
  KO
K09208  krueppel-like factor 9/13/14/16
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    312203 (Klf14)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    312203 (Klf14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6
Motif
Other DBs
NCBI-GeneID: 312203
NCBI-ProteinID: NP_001128566
RGD: 1306012
Ensembl: ENSRNOG00000027557
UniProt: D3ZVG6
Position
4q22
AA seq 321 aa AA seqDB search
MSASVACLDYFAAECLVSMSTRAVLHRRATDSEGAGAAAVSEVGEVSRESAGKGTGSRGV
LWIPPVLEVPAPSPGEGDGAPHLLAASALADLSCGAREGTKEDSEEAPCASTSCFEPTQC
SSPTGCSEPTQTFGEDELSDAESSCSESAILGAPEVPEEPDDSGEVPEGPPGARPGPAVG
PTYRRRQITPASKRHQCSFHGCNKAYYKSSHLKSHQRTHTGERPFSCDWLDCDKKFTRSD
ELARHYRTHTGEKRFSCPLCPKQFSRSDHLTKHARRHPTYHPDMIEYRGRRRTPRPEPPP
PAMVESSGSDSGQETSFTACP
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcctccgtggcttgcctggactacttcgctgcggagtgcctggtgtctatgtcc
acccgcgccgtgctgcaccggcgcgcaacggactccgaaggcgcgggcgcagcggctgtc
tccgaggtgggtgaggtgtcacgggagtcagcggggaagggtaccgggtcacggggggtg
ctgtggatacccccggtcctcgaggtccccgcccctagccccggcgaaggcgatggtgcg
ccccacctgctggctgcgagcgctttggctgatttaagctgtggtgcccgggaaggcacc
aaggaggactcggaagaagctccgtgtgcctcaacaagctgcttcgagccgacccagtgc
tccagccctactgggtgctctgagcctacccagaccttcggcgaggatgagctctctgac
gccgagagctcctgcagcgagtctgctatcctgggtgcgcctgaagtcccagaggagccg
gatgacagcggagaagtgcccgaggggcccccaggggcccgccctgggccagcagtgggt
cctacgtaccgcaggaggcagattacacccgcatccaagcgacatcagtgctccttccat
ggctgcaacaaagcctattacaagtcttcgcacctcaagtcacaccagcgtacccacacg
ggggagcgcccgttctcctgcgattggctcgactgcgacaagaagtttacgcgttcagac
gagctggcccgccactaccggacccacaccggtgaaaagcgcttctcctgcccgctgtgc
cccaagcagttctcccggagcgaccacctgaccaagcatgcccgtcgccacccaacttac
catcccgacatgatcgagtaccggggtcgtcgtcgcactcctcgccccgagccaccaccc
ccagccatggtggaaagctcgggctccgactcgggccaggagaccagcttcactgcttgc
ccgtag

DBGET integrated database retrieval system