KEGG   Rattus norvegicus (rat): 312213Help
Entry
312213            CDS       T01003                                 

Gene name
Plxna4, Plxna4a
Definition
(RefSeq) plexin A4
  KO
K06820  plexin A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    312213 (Plxna4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Plexin_cytopl Sema TIG TIG_2 TIG_plexin PSI PSI_integrin RasGAP
Motif
Other DBs
NCBI-GeneID: 312213
NCBI-ProteinID: XP_017448459
RGD: 1308074
Ensembl: ENSRNOG00000013072
UniProt: D3ZES7
Position
4q22
AA seq 1893 aa AA seqDB search
MKAMPWNWTCLLSHLLVVGMGSSTLLPRQPPQMSQKPSFVTFRGEPTEGFNHLVVDERTG
HIYLGAVNRIYKLSSDLKVLVTHQTGPDEDNPKCYPPRIVQTCNEPLASTNNVNKMLLID
YKENRLIACGSLYQGICKLLRLEDLFKLGEPFHKKEHYLSGVNESGSVFGVIVSYSNFDD
KLFIATAVDGKPEYFPTISSRKLTKNSEADGMFAYVFHDEFVASMIKIPSDTFTVIPDFD
IYYVYGFSSGNFVYFLTLQPEMVSPPGSTTKEQVYTSKLVRLCKEDTAFNSYVEVPIGCE
RSGVEYRLLQAAYLSKAGAVLGRTLGVRPDDDLLFTVFSKGQKRKMKSLDESALCVFILK
QINDRIKDRLQSCYRGEGTLDLAWLKVKDIPCSSALLTIDDNFCGLDMNAPLGVSEMVRG
IPVFTEDRDRMTSVIAYVYKNHSLAFVGTKSGKLKKIRVDGPKGNALQYETVQVVDSGPV
LRDMAFSKDHEQLYIMSERQLTRVPVESCGQYRSCGECLGSGDPHCGWCVLHNTCTRKER
CERSREPRRFASEMKQCVRLTVHPNNISVSQYNVLLVLETYNVPELSAGVNCTFEDLSEM
DGLVIGNQIQCYSPAAKEVPRIITENGDHHVVQLQLKSKETGMTFASTSFVFYNCSVHNS
CLSCVESPYRCHWCKYRHVCTHDPKTCSFQEGRVKLPEDCPQLLRVDKILVPVEVIKPIT
LKAKNLPQPQSGQRGYECILNIQGMEQRVPALRFNSSSVQCQNTSYSYEGMEINNLPVEL
TVVWNGHFNIDNPAQNKVYLYKCGAMRESCGLCLKADPDFECGWCQSPGQCTLRQHCPAH
ESRWLELSGANSKCTNPRITEIIPVTGPREGGTKVTIRGENLGLEFRDIASHVKVAGVEC
IPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLADLKP
NRGPMSGGTQVTITGTNLNAGSNVVVMFGSQPCLFHRRSPSYIICNTTSSEEVLDMKVTV
QVDRARIRQDLVFQYVEDPTIVRIEPEWSIVSGNTPIAVWGTHLDLIQNPQIRAKHGGKE
HINICEVLNATEMTCQAPALALGPDHQSDLTERPEEFGFILDNVQSLLILNKTNFTYYPN
PVFEAFSPSGILELKPGTPIILKGKNLIPPVAGGNVKLNYTVLVGEKPCTVTVSDVQLLC
ESPNLIGRHKVMARVGGMEYSPGMVYIAPDSPLSLPAIVSIAVAGGLLIIFIVAVLIAYK
RKSRESDLTLKRLQMQMDNLESRVALECKEAFAELQTDIHELTSDLDGAGIPFLDYRTYT
MRVLFPGIEDHPVLRDLEVPGYRQERVEKGLKLFAQLINNKVFLLSFIRTLESQRSFSMR
DRGNVASLIMTVLQSKLEYATDVLKQLLADLIDKNLESKNHPKLLLRRTESVAEKMLTNW
FTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLV
LSCVSPDNANSPEVPVKILNCDTITQVKEKILDAIFKNVPCSHRPKAADMDLEWRQGSGA
RMILQDEDITTKIENDWKRLNTVAHYQVPDGSLVALVSKQVTAYNAVNNSTVSRTSASKY
ENMIRYTGSPDSLRSRTPMITPDLESGVKLWHLVKNHEHGDQKEGDRGSKMVSEIYLTRL
LATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHGIHDPHVRHTWKSN
CLPLRFWVNMIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYA
KDIPSYKNWVERYYSDIGKMPAISDQDMNAYLAEQSRMHMNEFNTMSALSEIFSYVGKYS
EEILGPLDHDDQCGKQKLAYKLEQVITLMSLDS
NT seq 5682 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatgccctggaactggacttgcctgctctcccacctgctggtggtagggatg
ggttcctctaccctgcttccgcgccagccaccccagatgtctcagaagccctcttttgtc
acattccgaggggagcccaccgagggcttcaatcaccttgtggtggatgagaggacaggg
cacatttatttgggggctgtcaacaggatctacaaactctctagtgacctcaaggtcttg
gtgactcatcagacagggccagacgaggacaaccccaagtgttacccacctcggattgtt
cagacctgcaatgagcccctggccagcaccaataacgtcaacaagatgctgcttatagac
tacaaagaaaacaggctgattgcatgtgggagcctataccagggtatctgcaagctcctg
aggcttgaggacctcttcaagttgggagagccctttcacaagaaggaacactacctctcg
ggggttaatgagagtggttcagtctttggggtgatcgtttcctacagcaacttcgatgat
aaactatttattgccacagcagtagatggcaaacctgaatattttcctaccatctccagc
aggaagctgactaagaactctgaggcggatggcatgtttgcttatgttttccatgatgaa
tttgtggcctctatgattaagatcccttcagacaccttcacggttatccccgactttgac
atttactatgtctatggtttcagcagtggcaactttgtctactttttgacccttcagcca
gagatggtgtcccccccaggttccacgaccaaggagcaggtgtacacctcaaagcttgtg
aggctctgcaaagaggacacagccttcaattcctatgtagaggtgcccattggctgtgag
cgcagtggggtggagtatcgcttactacaggctgcctacctgtctaaggctggtgcagtg
ctcggccggaccctgggtgtccgcccagatgatgacctcctcttcaccgtcttctccaag
ggccagaagaggaagatgaaatctctggatgagtctgccctgtgcgtcttcatcttgaag
cagatcaatgatcgcattaaggaccgcctacagtcctgttataggggcgagggaacgctt
gacctggcctggctcaaggtgaaggacatcccttgcagcagcgcgctccttaccattgat
gacaacttctgtggcctggatatgaatgctcctctgggagtgtctgaaatggtacgtggc
attccagtcttcacagaagacagggaccgcatgacctccgtcatcgcatacgtctacaag
aatcactctctggccttcgtgggcaccaaaagtggcaagctaaaaaagatccgggttgat
gggcccaagggcaatgccctccagtatgagactgtacaggtggtggactcaggaccagtc
ctccgggacatggccttttccaaggaccacgagcaactctacatcatgtcagaaaggcag
cttactagagttcctgtggagtcctgtgggcaatatcggagctgtggcgagtgtcttggc
tcaggtgacccccattgtggctggtgtgtgctccacaacacgtgcacccggaaagaacgg
tgtgaacgctccagggagccccgaagatttgcctcagagatgaagcagtgtgtccggctg
acggtccatcccaacaacatctctgtctctcagtacaacgtgctgctggtcctagagaca
tacaatgtcccggaactgtcagcaggtgtcaactgtacctttgaggatctgtcagagatg
gatgggctggtaataggcaatcagatccagtgctactcccctgcagccaaggaggtgccc
cggatcatcacagaaaatggggaccatcatgttgtccagctgcaactcaagtcaaaggag
actgggatgaccttcgccagcaccagctttgtcttctacaactgcagtgtccacaattca
tgtctgtcctgtgtggagagcccataccgctgccactggtgtaaataccggcatgtttgt
acccatgaccccaagacatgctccttccaggaaggccgagtgaagctccctgaggactgc
ccccagctgctgcgagtggacaagatcctggttccagtagaggtgatcaagcccatcact
ctgaaggctaagaacctcccacagcctcagtcgggacagagaggctacgagtgcatcttg
aacatccaaggcatggagcagagggtacctgccctgcgcttcaacagctccagtgtgcag
tgtcagaacacctcctattcctatgaagggatggagatcaacaacctgccagtggagctg
acagtcgtgtggaatggacacttcaacatcgacaacccagctcagaataaagtttacctc
tacaagtgtggggccatgcgtgagagctgtgggctgtgcctcaaggctgacccggatttc
gagtgtggctggtgtcagagccctggacagtgtactctacgccagcattgccctgcccat
gagagccggtggctagaactgtcaggtgccaatagcaaatgcaccaaccctcggatcaca
gagatcatcccagtgacaggccctcgggaggggggcaccaaagtcaccatccgaggggag
aacttgggcctggaattccgtgacattgcttcacatgtcaaggtggctggtgtggaatgc
atccccttggtggatggctacatcccggcagaacagattgtgtgtgagatgggagaggcc
aagcctagccagcacgcgggctttgtggagatctgtgtggctgtgtgtcggcctgagttc
atggcccgctcctcacagctctattacttcatgactctgactctagcagatctgaagccc
aaccgaggacccatgtctgggggtacccaggtcaccatcacaggcaccaacctgaatgca
ggcagcaatgtggtggtgatgtttgggagccagccctgcctcttccacaggcgctcacca
tcctacattatctgtaacactacgtcctcagaggaagtgttggacatgaaggtgactgta
caggtggacagggccaggatccgccaggacctggtctttcagtatgtggaggaccccacc
atcgtgcgtattgagcctgaatggagcattgtcagtgggaacacacctattgccgtctgg
ggaactcatctggacctcatacagaacccacagatccgtgccaagcacggagggaaagag
cacatcaacatctgtgaggtcctaaatgctactgagatgacctgccaggctccagccctt
gccctgggtcctgaccaccagtcagatctcactgagaggcctgaagaatttggtttcatc
ctggacaacgtccagtctctgctaattctgaacaagaccaacttcacctactatcctaac
cctgtgtttgaggctttcagtccctcaggaatcctggagctcaagcctggcacccccatt
atcctaaagggcaagaacctgatcccacctgtggctggaggcaatgtgaagctgaactat
actgtgctggttggggagaaaccatgcaccgtgacagtgtcagatgtgcagctgctctgc
gagtctcccaacctcatcggcaggcacaaagtgatggcacgggtgggtggtatggaatat
tcccctgggatggtgtacatcgccccagacagccctctcagcctgcccgccatcgtcagc
atcgcagtggctggtggtctcctcatcatctttattgtggctgtgctcattgcttacaaa
cgcaagtcccgagaaagtgacctcactctgaagaggctgcagatgcagatggacaacctt
gaatcccgtgtggccctggagtgcaaggaagcttttgcagagctgcagacagatattcat
gagcttaccagtgacctggatggagctgggattccttttctggactacaggacctatacc
atgcgggtgctgttcccagggattgaagaccaccctgtgctacgagaccttgaggtccca
ggctaccgtcaggagcgtgtggagaaaggattgaagctcttcgcccagctcatcaacaac
aaggtgttcctactctctttcatccgcactcttgagtctcagcgcagtttttccatgcgc
gaccgaggcaacgtggcctcgctcatcatgactgtacttcagagcaagctagagtatgcc
actgatgtgctgaagcagctcctggctgacctcattgataagaacctggagagcaagaac
catcccaagctgctactcaggaggacggagtcggtggccgagaagatgttgactaattgg
ttcactttcctcctctacaagttcctcaaggagtgtgctggggagcccctcttctccctg
ttctgtgccatcaagcagcagatggagaaaggtcctatcgatgccatcacaggagaggct
cgctactcactaagtgaggacaagctcatccggcagcagattgaatataagaccctggtc
ctgagctgtgtcagtccagataacgctaacagcccagaggtcccagtgaagatcctcaac
tgtgacacaatcactcaggtcaaggagaagatcctagacgccatcttcaagaatgttcca
tgctcccatcggcccaaagctgcagacatggacctggagtggcgacaaggaagtggggcg
agaatgattctgcaggacgaagatatcaccaccaagattgagaatgattggaagagactc
aacacagtagcccactaccaggtgccggatggttccttggtggctttagtgtccaagcaa
gtgacagcctataatgcagtgaataactccactgtctccaggacctcagcgagtaaatat
gaaaacatgatccggtacacaggcagccctgacagcctccgttcccgaacacccatgatc
acccctgacctggaaagtggggtcaagctgtggcatctggtgaagaaccatgaacatgga
gaccagaaagagggggatcgggggagcaagatggtgtctgagatctatctgacacgactg
ctggccacaaagggcacactgcagaagtttgtggatgacctgttcgagaccatcttcagc
acagcccaccgtggttccgctctgcccctagccatcaagtacatgtttgacttccttgat
gagcaggctgataagcatggcatccatgacccgcatgtccgccatacctggaagagcaac
tgcctgcccctacggttttgggtgaatatgatcaagaaccctcagtttgtgtttgacatc
cataagaacagcatcacagatgcctgcctctctgtggtggcccagactttcatggactcc
tgctccacctcggagcaccgactgggcaaggattccccctcgaacaagctgctctacgcc
aaggacattcccagctacaagaactgggtagagaggtattattcagacattgggaagatg
ccggcgataagtgaccaggacatgaacgcgtacctggctgagcaatcgcggatgcacatg
aatgagttcaacacaatgagtgcgctctcggagatcttctcctatgtgggcaaatacagt
gaggagatccttggacccctggaccatgatgaccagtgtggaaagcagaaactggcttac
aaactagaacaagtcataaccctcatgagcttagacagctga

DBGET integrated database retrieval system