KEGG   Rattus norvegicus (rat): 312279Help
Entry
312279            CDS       T01003                                 

Gene name
Epha1
Definition
(RefSeq) Eph receptor A1
  KO
K05102  Eph receptor A1 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    312279 (Epha1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    312279 (Epha1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     312279 (Epha1)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   312279 (Epha1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ephrin_lbd Pkinase fn3 SAM_1 EphA2_TM SAM_2 Ephrin_rec_like Pur_ac_phosph_N Haspin_kinase Tissue_fac
Motif
Other DBs
NCBI-GeneID: 312279
NCBI-ProteinID: NP_001101328
RGD: 1304680
Ensembl: ENSRNOG00000017525
UniProt: D3ZDH4
Position
4q24
AA seq 977 aa AA seqDB search
MERRWPLGLALLLLLLCAPLPPGARAEEVTLMDTSTAQGELGWLLDPPETGWSEVQQMLN
GTPLYMYQDCPIQEGGDTDHWLRSNWIYRGEEASRVHVELQFTVRDCKSFPGGAGPLGCK
ETFNLFYMESDQDVGIQLRRPLFQKVTTVAADQSFTIRDLASGSVKLNVEHCSLGHLTRR
GLYLAFHNPGSCVALVSVRVFYQRCAETVHGLAHFPHTLPGPTGLVEVAGTCLSHAQISL
GSSGTPRMHCSPDGEWLVPVGQCQCEPGYEESGGSVGCTACPTGFYRMDMNTLHCLKCPQ
HSVAESEGSTICTCENGHYRAPGEGPQVACTRPPSAPQNLSFSASGTQLSLRWEPPRDTG
GRQDIRYSVECLQCRGIAQDGGPCQPCGKGVHFSPAASGLTASTVQVEGLEPYANYTFTI
KSQNRVSGLDSSSPSSASLSINMGQAESLSGLSLKLVKKEPRQLELTWAGSRLQNPGGNL
SYELHVLNQDEEWHQMVLEPRVLLTKLQPDTTYIVRVRTLTPLGPGPFSPDHEFRTSPPV
SRSLTGGEIVAIIFGLLLGIALLIGIYVFRSRRGQRQRQQRQRERTTNVDREDKLWLKPY
VDLQAYEDPAQGALDFAQELDPAWLIVDTVIGEGEFGEVYRGALRIPSQDCKTVAIKTLK
DTSPDGYWWNFLREATIMGQFNHPHILRLEGVITKRKPIMIITEFMENGALDAFLKERED
QLVPGQLVAMLLGIASGMNYLSGHNYVHRDLAARNILVNQNLCCKVSDFGLTRLLDDFDG
TYETQGGKIPIRWTAPEAIAHRIFTTASDVWSFGIVMWEVLSFGDKPYGEMSNQEVMKSI
EDGYRLPPPVDCPAPLYELMKNCWAYDRARRPHFLQLQAHLEQLLTDPHSLRTIANFDPR
VTLRLPSLSGSDGIPYRSVSEWLESIRMKRYILHFRSAGLDTMECVLELTAEDLTQMGIT
LPGHQKRILCSIQGFKD
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atggagcggcgctggcccctggggctcgcactgctgctgctgctgctctgcgccccgctg
cccccgggggcgcgcgccgaggaagtcactttaatggacacgagcacagcacaaggagag
ttgggctggcttctggatcccccagagactgggtggagtgaggtgcaacaaatgctgaac
gggacacccctgtacatgtaccaagactgcccaatacaggaaggtggagatactgaccac
tggcttcgctccaactggatctaccgaggagaggaagcctcacgtgtccacgtagagctg
cagttcactgtgcgggactgtaaaagtttcccagggggagctgggcctctgggatgcaaa
gagaccttcaaccttttctacatggagagtgaccaggatgtgggcattcaactccgacgg
cctttgttccaaaaggtaacaactgtggcagcagaccagagcttcaccatcagagacctg
gcctctggctctgtaaagctgaacgtagagcactgctccttgggtcacctcacccgccgt
ggtctctacctagctttccacaacccgggatcctgtgtggcgctcgtatctgtaagggtg
ttctaccagcgctgcgcagagactgtgcatggcttggcccacttccctcacactctccct
ggacctacagggttggtagaagtagctggaacctgcctctcccatgcacagatcagcctg
gggtcctcaggtacaccacgcatgcattgcagccctgatggcgagtggttggtgcctgtg
ggtcagtgccagtgcgagcctggctatgaggaaagcggtggaagtgtgggatgcactgcc
tgtcctactggtttctatcgaatggacatgaatactctccactgtctcaagtgcccccaa
catagcgtagcagagtctgaggggtctaccatctgtacctgtgagaatggacattatcga
gcccctggggagggcccccaggtagcatgcacgcgtcccccatcagctccccaaaatctg
agcttctctgcatcaggcactcagctctccctacgctgggagcccccaagagatacaggg
ggacgccaagatatcagatacagtgtggaatgcttgcagtgtcggggcattgcacaggat
gggggtccctgccaaccctgtggaaaaggtgtgcacttttccccggcagcttccgggctc
accgcatctactgtgcaagttgaaggcctcgagccttatgccaactacacgtttaccatc
aaatcccagaacagagtgtcgggactggacagttccagccctagcagcgcttctctcagt
atcaacatggggcaagcagagtcactctctggcctgtcactgaagctggtgaagaaagag
ccgaggcagctggagctgacttgggcagggtcccgactccaaaaccctggggggaatctg
agctatgagctgcacgtgctgaaccaggatgaagaatggcaccaaatggtgctggaaccc
agggtcttgctgacaaaacttcagccagataccacatacattgtcagagtacgaacactg
accccactggggcctggccctttctcccctgaccatgagttccggacaagcccaccagtt
tccagaagcctgactggaggagagattgtggccatcatctttggattgctgcttggaata
gctctgctgatcgggatttatgtcttccgttcaaggagaggccagcgacagagacagcag
aggcagcgtgaacgcaccaccaatgtcgatcgagaggacaagctgtggctaaaaccctat
gtggacctccaggcctatgaggaccctgcacagggagccttagactttgcccaggaactg
gaccctgcctggctgattgtggacactgtcataggagaaggggagtttggggaagtgtat
cggggagccctgagaatccccagccaagactgcaagaccgtggccattaagaccttgaaa
gacacatccccagatggctactggtggaatttccttcgagaagcaactatcatgggccag
ttcaaccacccacacattctacgcctagaaggtgtcatcacgaaaagaaagccgatcatg
atcatcacagaatttatggaaaatggagcccttgatgcctttctgaaggaacgggaggac
cagctagttcctggtcagctagtggctatgcttctgggcatagcatcaggcatgaactac
ctcagtggccacaattatgtccatagagacctggctgccaggaacatcttggtgaatcag
aacttgtgctgcaaggtatctgactttggcctgacccgcctcctggatgacttcgatggc
acctatgaaacccagggaggaaagatccctatccgttggacagccccagaagctattgcc
catcggatcttcaccacagccagtgatgtttggagctttgggattgtaatgtgggaggtg
ttgagttttggcgacaaaccctatggggagatgagcaatcaagaggtaatgaaaagcatt
gaggatgggtaccggctgccccctcctgtggattgtcctgcccccctgtatgaactcatg
aagaactgctgggcttacgaccgtgcccgtcggccccacttcctccagctgcaggcacat
ctggaacagctgctcacggacccccattccctaaggacaattgccaactttgaccctagg
gtgaccctacgtctgcccagcctgagtggctctgatgggatcccttatcgaagtgtctct
gagtggcttgaatccatacgcatgaagcgctacatcctgcacttccgctcggcaggcctg
gacaccatggagtgtgtgctggagctgacagccgaggacctgacgcagatgggaatcaca
ttgccagggcaccagaagcgcattctctgcagtattcaaggatttaaggactga

DBGET integrated database retrieval system