KEGG   Rattus norvegicus (rat): 312299
Entry
312299            CDS       T01003                                 

Gene name
Ezh2
Definition
(RefSeq) enhancer of zeste 2 polycomb repressive complex 2 subunit
  KO
K11430  [histone H3]-lysine27 N-trimethyltransferase EZH2 [EC:2.1.1.356]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00310  Lysine degradation
rno01100  Metabolic pathways
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    312299 (Ezh2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    312299 (Ezh2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    312299 (Ezh2)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.356  [histone H3]-lysine27 N-trimethyltransferase
     312299 (Ezh2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     312299 (Ezh2)
   Polycomb group proteins
    PRC2-EZH2 complex
     312299 (Ezh2)
SSDB
Motif
Pfam: PRC2_HTH_1 SET EZH2_WD-Binding preSET_CXC
Other DBs
NCBI-GeneID: 312299
NCBI-ProteinID: NP_001128451
RGD: 1595860
Ensembl: ENSRNOG00000006048
UniProt: B5DFE2
Position
4q24
AA seq 746 aa
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKTMFSSNRQKILERTETLNQEW
KQRRIQPVHIMTSVSSLRGTRECSVTSDLDFPAQVIPLKTLNAVASVPIMYSWSPLQQNF
MVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQ
YNDDDDDDDGDDPDEREEKQKDLDDSRDDKETCPPRKFPADKIFEAISSMFPDKGTAEEL
KEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFH
ATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPN
NSSRPSTPTISVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKM
KPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPV
PTEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQ
NFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVS
CKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDK
YMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGE
ELFFDYRYSQADALKYVGIEREMEIP
NT seq 2241 nt   +upstreamnt  +downstreamnt
atgggccagactgggaagaaatctgagaagggaccggtttgttggcggaagcgtgtaaag
tcagagtacatgagactgagacagctcaagaggttcagaagagctgacgaagtaaagact
atgtttagttccaatcgtcagaaaattttggaaagaactgaaaccttaaatcaagaatgg
aagcagcgaaggatacagcctgtgcacatcatgacttctgtgagctcattacgcgggact
agggagtgttcagtgaccagtgacttggattttccagcacaagtcatcccgttaaagacc
ctaaatgctgtcgcatcggtgcccataatgtattcttggtctcccttacaacagaatttt
atggtggaagatgaaactgttttacataacattccttatatgggggatgaagttctggat
caggatggcactttcattgaagaattaataaaaaattatgatggaaaagtgcatggagac
agagaatgtggatttataaatgatgaaatttttgtggagttggtaaatgctcttggtcaa
tataatgatgatgacgatgatgatgatggagacgatcctgatgaaagagaagaaaaacag
aaagatctagacgatagtcgagatgataaagaaacttgcccacctcggaaatttcctgct
gataaaatatttgaagccatttcctcaatgtttccagataagggcacagcagaagaactg
aaagaaaagtataaagaactcacggagcagcagctccccggtgctctacctcctgaatgt
accccaaacatcgatggaccaaatgccaaatctgttcagagggagcaaagtttacattca
tttcatacgctcttttgtcgacgatgttttaagtatgactgcttcctacatccctttcat
gcaacacccaacacatataagaggaagaacacagaaacagctctggacaacaagccttgt
ggaccacagtgttatcagcatctggagggagctaaggagtttgctgctgcccttactgct
gagcggataaagacaccacctaaacgtccagggggccgcagaagaggaagacttccgaat
aacagtagcagacccagcacccccaccatcagtgtgctggagtcaaaggatacagacagt
gacagagaagcagggactgaaaccgggggagagaacaacgataaagaagaagaagagaaa
aaagatgagacttccagttcctctgaagcaaattctcggtgtcaaacaccaataaagatg
aagccaaatattgaacctcctgagaatgtggagtggagtggtgctgaagcctccatgttt
agagtcctcattggtacttactacgataacttttgtgccattgctaggctaattgggacc
aaaacatgtagacaggtgtatgagtttagagtcaaagagtccagtatcatagcacctgtt
cccactgaggatgtggacactcctccaagaaagaagaaaagaaaacatcggttgtgggct
gcacactgcagaaagatccaactgaaaaaggacggctcctctaaccatgtttacaactat
caaccctgtgaccatccacggcagccttgtgacagttcgtgcccttgtgtgatagcacaa
aatttttgtgaaaagttttgtcaatgtagttcagagtgtcaaaaccgctttcctggatgc
cggtgcaaagcacaatgcaacaccaagcagtgtccgtgctacctggctgtccgagagtgt
gatcctgacctctgtctcacttgtggagctgctgaccactgggacagtaaaaatgtgtcc
tgcaagaactgtagcattcagcggggctctaaaaagcacttactgctggcaccgtctgat
gtggcaggctggggcatctttatcaaagatccagtacagaaaaatgaattcatctcagaa
tactgtggagagattatttctcaggatgaagcagacagaagagggaaagtgtatgacaaa
tacatgtgcagctttctgttcaacttgaacaatgattttgtggtggatgcaacccgcaag
ggcaacaaaattcgttttgctaatcattcagtaaatccaaactgctatgcaaaagttatg
atggttaatggtgaccacaggataggcatctttgctaagagagctatccagactggtgaa
gagttgttctttgattacagatacagccaggctgatgccctgaagtatgtgggcatcgaa
cgagaaatggaaatcccttga

DBGET integrated database retrieval system