KEGG   Rattus norvegicus (rat): 312320Help
Entry
312320            CDS       T01003                                 

Gene name
Igf2bp3, Ab2-255, RGD1306512
Definition
(RefSeq) insulin-like growth factor 2 mRNA binding protein 3
  KO
K13197  insulin-like growth factor 2 mRNA-binding protein 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    312320 (Igf2bp3)
   03041 Spliceosome [BR:rno03041]
    312320 (Igf2bp3)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     312320 (Igf2bp3)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    312320 (Igf2bp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KH_1 KH_2 KH_4 RRM_1 KH_5 MOEP19
Motif
Other DBs
NCBI-GeneID: 312320
NCBI-ProteinID: XP_003749789
RGD: 1306512
Ensembl: ENSRNOG00000009052
UniProt: A0A0G2K0Y2
Position
4q24
AA seq 579 aa AA seqDB search
MNKLYIGNLSDHAGPADLESVFKDAKIPVAGPFLVKTGYAFVDCPDEGWALKAIEALSGK
MELHGKPMEVEHSVPKRQRIRKLQIRNIPPHLQWEVLDSLLVQYGVVESCEQVNTDSETA
VVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPDETAAQQSPSPQLRGRRGPGQRGSS
RQTSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQSKIDVHRKENTGAA
EKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLK
KIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNL
QAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAI
IGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFV
SPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKIT
GHFYACQVAQRKIQEILTQVKQHQQQKALQSGAPQSRRK
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaattgtacatcgggaacctcagcgaccacgccggccccgcggacctggaaagt
gtcttcaaggacgctaagatcccggtggccggccccttcctggtgaagacgggctacgcg
ttcgtggactgcccggacgagggctgggccctcaaggccatcgaggcgctttcaggtaaa
atggaactacatgggaaaccgatggaagttgagcactcggtccccaaacggcagaggatt
cggaaacttcagatacgaaatatcccaccccacttacaatgggaggtgctggatagttta
ctagtccagtatggagtggtggagagctgtgagcaagtgaacacggactcggaaacagca
gttgtaaatgtaacctattccagtaaggaccaagctagacaagccttagacaaactgaat
ggattccagttagagaacttcaccttgaaggttgcctacatcccagatgaaactgctgcc
cagcaaagcccctcacctcagctccgagggcgccgggggccagggcagcggggctcatcc
aggcagacgtctccaggatccgtgtccaagcagaagccctgtgacctgccgctgcgcctg
ctggtgcccacccagtttgttggagccattataggaaaagaaggtgccaccattcgcaac
atcaccaaacagacccagtctaagatcgatgtccatcgtaaggagaatacaggggccgcg
gagaagtccattactatcctctctacccctgaaggcacttctgcagcttgtaagtctatt
ctggagattatgcataaggaagcgcaagatataaaattcacagaggagatccccttgaag
attttagctcacaataactttgtaggccgtctcattggtaaagaaggaaggaaccttaaa
aaaattgagcaagacacggacactaaaatcacgatatctccattgcaggaactgacgttg
tacaatccggagcgtaccattacagttaaaggcaatgttgagacgtgtgccaaggctgag
gaggaaataatgaagaagatcagggagtcctatgaaaatgacattgcttccatgaatctt
caagcacatttaatccctggattaaatctgaatgccttgggtctgttcccacccacttca
gggatgccacctcccacctcagggcccccttcagccatgactcctccctaccctcaattt
gagcaatcagagacggagaccgtgcacctgttcatccccgccctgtcggtcggtgccatc
attggcaagcagggtcaacacatcaaacagctttctcgttttgcaggagcttcgattaag
atcgcgccagccgaagcaccagatgctaaagtgaggatggtgatcatcactggaccacca
gaggctcagttcaaggctcaggggagaatttatggaaaaattaaagaagaaaactttgtg
agtcctaaggaagaggtgaaacttgaagctcacatcagagtgccgtcctttgctgctggc
agagtcattgggaaaggaggcaaaacggtgaatgaactccagaatttatcaagtgctgag
gttgttgtcccccgtgaccagacacctgatgagaatgatcaagtcgttgtcaaaataact
ggccacttctatgcttgccaggttgcccagaggaaaattcaggaaattctgactcaggta
aagcagcaccaacagcagaaagctctgcagagtggagcacctcagtcaaggcggaagtaa

DBGET integrated database retrieval system