KEGG   Rattus norvegicus (rat): 312373
Entry
312373            CDS       T01003                                 

Gene name
Nt5c3a, Nt5c3
Definition
(RefSeq) 5'-nucleotidase, cytosolic IIIA
  KO
K24242  cytosolic 5'-nucleotidase 3 [EC:3.1.3.5 3.1.3.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00240  Pyrimidine metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    312373 (Nt5c3a)
   00240 Pyrimidine metabolism
    312373 (Nt5c3a)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     312373 (Nt5c3a)
    3.1.3.-  
     312373 (Nt5c3a)
SSDB
Motif
Pfam: UMPH-1 HAD zf-ANAPC11 CIDE-N Hydrolase
Other DBs
NCBI-GeneID: 312373
NCBI-ProteinID: NP_001101332
RGD: 1312013
Ensembl: ENSRNOG00000005981
UniProt: B2GUX5
Position
4q24
AA seq 297 aa
MTNQESAVRLEMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYN
GKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGL
LIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGV
YHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQ
GDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL
NT seq 894 nt   +upstreamnt  +downstreamnt
atgactaatcaggagtctgctgtccgtttggaaatgatgccagaatttcagaaaagctca
gttcgtatcaagaacccaacgagagtagaagaaattatctgtggtctcattaaaggaggc
gctgccaaacttcagataataaccgactttgatatgactctaagtaggttctcctacaat
gggaaaagatgcccaacatgtcataatatcattgacaactgtaagctcgttacagatgaa
tgtcgaagaaagttactgcagctaaaggagcagtactacgctattgaggttgatcctgtt
ctcaccgtggaagagaagttcccttacatggtagaatggtataccaaatcgcatggtttg
cttattgaacaaggcataccaaaagctaaacttaaagagattgtggctgactctgatgtc
atgctcaaggaaggatatgagaatttcttcggtaaacttcaacagcacggtatccctgtg
ttcatattttcggctggtatcggtgacgtacttgaagaagttatccggcaggctggagtt
tatcactcaaacgtcaaagtagtgtctaacttcatggattttgatgaaaatggagtgctg
aaaggattcaaaggagagctaattcatgtattcaacaaacatgatggtgccctgaagaat
acagactacttcagccaactgaaagacaacagcaacatcattctgctgggggactcccaa
ggagacttaaggatggccgatggtgtagccaacgtcgaacacattctgaaaattggttat
ctgaatgacagagtagacgagcttttagaaaaatacatggactcttatgatattgtttta
gtaaaagaagaatcactggaggttgtcaactctattttacagaagacattataa

DBGET integrated database retrieval system