KEGG   Rattus norvegicus (rat): 312444
Entry
312444            CDS       T01003                                 

Gene name
Immt
Definition
(RefSeq) inner membrane mitochondrial protein
  KO
K17785  mitofilin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    312444 (Immt)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    312444 (Immt)
   MINOS/MitOS complex (yeast)
    312444 (Immt)
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Morphogenesis factors
    312444 (Immt)
SSDB
Motif
Pfam: Mitofilin
Other DBs
NCBI-GeneID: 312444
NCBI-ProteinID: NP_001030100
RGD: 1310684
Ensembl: ENSRNOG00000009097
UniProt: Q3KR86
Position
4q31
AA seq 609 aa
MLRACQLSGVTVAAQSCLCGKFVLRPLRPCRRYSTSSSSGVTAGKIAGAGLLFVGGGIGG
TILYAKWDSHFRESVEKTIPYSDKLFGMVLGSAPYTVPLPKKPIQSGPLKISSVSEVMTD
SELPMAQTQETNGDTPASAAGDPAPEVEHEDTINTECPNTDEGTSTFVTAALAKSLEDAL
NQTATVTRQTITAQNAAVQAVKAHSSTLKTAMDNSEIAGEKKSAQWRTVEGALKERRKAV
DEAADALLKAKEELEKMKTIIEDAKKREIAGATPYITAAEEKLHSMIVDLDSVVKKVQAA
QSEAKVVSQYHELVVQARDDFRKELDSITPDITPGWKGMSISDLAGTLSTDDLNALIAHA
HRRIDQLNRELAQQKATEKQHIELALERQKLEEKRAFDSAVAKALEHHRSEIQAEQDRKV
EEVRDAMENEMRTQLRRQAAAHTDHLRDVLKVQEQELKFEFEQDLSEKLSEQELEFHRRS
QEQMDNFTLDINTAYARLRGIEQAVQSHAVAEEEARKAHQLWLSVEALKYSMKTSSAEMP
TIPLGSAVEAIRVSCSDNEFTQALTAAIPPESLTRGVYSEETLRARFYAVQKLAGRVAMI
DETKNSLYQ
NT seq 1830 nt   +upstreamnt  +downstreamnt
atgctgcgggcctgtcagttatccggcgtgaccgtcgcggcccagagttgtctgtgtggg
aagtttgtcctccgcccactacgaccatgccgtagatactccacttcaagcagttctggg
gtgactgctggtaaaattgctggagctggccttttgtttgttggtggagggattggtggc
actatcctgtatgccaaatgggattcccatttccgggaaagtgtagaaaaaactattcct
tattcagacaagctctttgggatggttcttggctctgcaccttatactgttccattgcca
aagaaaccgattcagtctggtccactaaaaatctccagcgtatcagaggtgatgacagac
tctgaactgcccatggcacagacccaggaaacgaacggggatactccagcttcagcagca
ggtgatccggcccctgaggttgagcatgaggacactataaacaccgaatgtcccaacact
gatgaaggaacatctacattcgtaactgcagctctagccaagagtttagaagatgctctg
aaccagactgcaaccgtcactcggcagactattacagcccagaatgctgcagttcaggct
gtcaaggcacactccagcacactgaaaacagccatggacaattctgagattgcaggtgag
aagaagtcagcccagtggcgaacagtggagggtgcgttgaaggagcgaagaaaggcagtt
gacgaagctgctgatgcccttctcaaagccaaagaagagttagagaagatgaaaactata
attgaagatgcaaagaaaagagagattgctggggccaccccttatataactgctgcagag
gagaaactgcacagcatgatagtggatctggatagcgtggtcaaaaaggtccaggctgct
cagtcagaggctaaggtggtgtctcaatatcatgaacttgtggtccaagcaagggatgac
tttagaaaagagctggacagcatcactccagacatcactcctggatggaaagggatgagt
atttctgacctagctggcacactctccactgacgacctgaacgcgctcattgctcatgcc
caccgtcgcattgatcagctcaacagagagctagcgcaacagaaagccacagagaagcag
cacatcgagctagccctggaaaggcaaaagctagaagaaaagcgagcctttgactctgcg
gtggcaaaagcgttggagcaccatagaagtgaaattcaggctgagcaagacagaaaggta
gaggaagtcagagatgccatggagaatgaaatgcggacccaacttcgacgacaggcagct
gcccacactgatcatttgcgagatgtcctcaaggtgcaagaacaggaactgaagtttgaa
tttgaacaggacctgtctgagaaattgtctgagcaagaattagagtttcatcgtcgcagt
caagaacaaatggacaactttactctggacataaatactgcctatgcaaggttgagagga
attgagcaggctgttcagagtcatgcagttgctgaagaagaagccagaaaagcccaccag
ctctggctttcagtggaggcattaaagtacagcatgaagacctcatctgcagaaatgcct
accatcccactggggagtgcagttgaggccatcagagtcagctgttctgataatgaattt
acccaggctttaactgcagccattcctccagagtccctgacccggggggtatacagtgaa
gagaccctaagagcccgtttctatgctgttcaaaaactagctggaagggtagcgatgatt
gatgaaaccaaaaatagcctgtaccaataa

DBGET integrated database retrieval system