KEGG   Rattus norvegicus (rat): 312477
Entry
312477            CDS       T01003                                 

Gene name
Dok1
Definition
(RefSeq) docking protein 1
  KO
K14752  docking protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    312477 (Dok1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   312477 (Dok1)
SSDB
Motif
Pfam: IRS PH HemS
Other DBs
NCBI-GeneID: 312477
NCBI-ProteinID: NP_001020587
RGD: 1309499
Ensembl: ENSRNOG00000007412
UniProt: Q4QQV2
Position
4
AA seq 480 aa
MDGALMEGPLFLQSQRFGTKRWKKTWAVLYPASPHGVARLEFFDHKGSSSGGGRGGSRRL
DCKMIRLAECVSVVPVTVESPPEPGASAFRLDTAQRSHLLAADAASSTAWVQILCRTAFP
KGGWALAQTENPPKFSALEMLENSLYSPTWEGSQFWVTSQKTEASERCGLQGSYVLRVEA
EKLTLLTLGAQSQILEPLLFWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGND
IFQAVEAAIQQQKAQGKVGQGQDITRTDSHDGETEGKMAPTPVPQEPLGSPPALYAEPLD
SLRIPPGPSQDSLYSDPLGSTPAGAGEGVQRKKPLYWDLYGHVQQQLLKTKLIDSKEDPI
YDEPEGLAPAPLRGLYDLPQEPKDAWWCQARLKEEGYELPYNPATDDYAVPPPRSSKPTP
APKPQGLILPESGTTAGSGSKGSDTALYSQVQKSGTPGRWDCGLSRVGNDRVGVKSEGST
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggacggggctttgatggagggtccgctttttctgcagagtcagcgcttcgggaccaag
aggtggaagaaaacttgggctgtgctttacccagccagccctcacggcgtggcgcggctg
gaattctttgatcacaaggggtcgagctctggagggggtcgaggcggctctcgccgtcta
gactgcaagatgatacgcctggctgaatgtgtgagcgtggtgcctgtgactgtggagagt
ccccctgagcccggcgcctctgccttccgcctggacaccgcacaacgctcgcacctgctt
gcagcggacgccgcatccagcactgcctgggtgcagattttatgcagaaccgcttttccg
aaaggcggctgggctttggctcagacggagaacccacctaagttttctgccctggagatg
ctggagaattcgctgtacagccccacctgggaaggatcccaattctgggtaacctcgcag
aagaccgaggcttctgaacgctgcggcttgcaaggctcctacgtactgagggtagaagct
gagaagctgacccttctgactttgggtgcacagagtcaaatcctggagccgctccttttc
tggccctacactctgttgcgacgctatggccgagacaaggtaatgttctcctttgaagcg
ggtcgccgctgcccctctggccctgggaccttcaccttccagactgcccagggaaatgac
atctttcaggcagttgaggctgctatccagcagcagaaagcccaaggaaaggtgggacag
ggacaagatatcaccagaactgactcccatgatggggagacagaggggaagatggctccc
actcctgttccccaggaacccctgggcagccctccagccctatatgcagagcctttagac
tccctgcgaattcctccaggcccttctcaggactctttgtattcagaccccctgggcagc
acccctgctggggcaggggaaggggtgcagcggaagaaacctctctattgggatttgtat
gggcacgtgcagcagcagttgctgaaaaccaagctgatagactccaaagaggaccccatc
tatgatgagcctgagggcctggcccctgcccctctccggggcctttatgatctgcctcag
gagcctaaggatgcatggtggtgccaggctcggctgaaggaagagggctatgagctccct
tacaaccccgccaccgacgactacgctgtgccaccccctcggagctcaaagcctacccct
gcccccaagccacagggcttgatccttcctgaatctggtaccacagctggcagtggcagc
aaaggctcagatacagctctgtacagccaggtccagaaaagtgggaccccagggagatgg
gactgtggactctctagagtagggaatgacagggtgggggtcaagtcagagggttccacc
tga

DBGET integrated database retrieval system