KEGG   Rattus norvegicus (rat): 312480Help
Entry
312480            CDS       T01003                                 

Gene name
Pcgf1, Nspc1
Definition
(RefSeq) polycomb group ring finger 1
  KO
K11487  polycomb group RING finger protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    312480 (Pcgf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    312480 (Pcgf1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    Other polycomb group proteins
     312480 (Pcgf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-rbx1 zf-RING_5 Rad60-SLD zf-RING_UBOX zf-Nse Atg8 zf-ANAPC11 zf-C3HC4_4 Prok-RING_4 ubiquitin
Motif
Other DBs
NCBI-GeneID: 312480
NCBI-ProteinID: NP_001007001
RGD: 1549782
Ensembl: ENSRNOG00000008360
UniProt: Q6DLV9
Position
4q34
AA seq 243 aa AA seqDB search
MRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCI
VKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIRDFYQSRGL
DRVSQPSGEEPALRGLGLPFTSFDHYYRYDEQLSLCLERLSSGKDKNKNVLQNKYVRCSV
RAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQLWLSRWFGKPSPLLLQYSVKE
KRR
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaggcttcggaaccagctccagtcagtgtacaagatggacccactacggaacgaggag
gaggtccgggtgaagatcaaagacctgaatgaacacatcgtttgctgcctatgcgcgggc
tacttcgtggacgccaccactatcacagagtgcctccacaccttctgcaaaagttgtatc
gtgaagtacctgcagaccagcaagtactgccccatgtgtaacatcaagatccacgagacg
cagccgttgctcaatctcaaactggatcgggtcatgcaggacatagtgtataagctagta
ccaggcttgcaagacagtgaagagaaacggattcgggatttctatcagtcccgaggcttg
gacagagtctcccagcccagtggtgaagagccagccctgaggggcctgggcctccccttc
accagttttgaccactattatcgatacgatgagcagctgagcctatgcctggagcggctg
agttctggcaaagacaagaataaaaatgtccttcagaacaagtatgttcgatgttctgtt
agagctgaggtccgccatctccgaagggttctgtgtcaccgactaatgctaaatccacaa
catgtacagctcctttttgacaatgaggttctccctgatcacatgacaatgaagcagcta
tggctttcccgctggttcggcaagccatctcctttgcttctacaatacagtgtgaaagag
aagaggaggtag

DBGET integrated database retrieval system