KEGG   Rattus norvegicus (rat): 312510Help
Entry
312510            CDS       T01003                                 

Gene name
Tia1
Definition
(RefSeq) TIA1 cytotoxic granule-associated RNA binding protein
  KO
K13201  nucleolysin TIA-1/TIAR
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    312510 (Tia1)
   03041 Spliceosome [BR:rno03041]
    312510 (Tia1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     312510 (Tia1)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    312510 (Tia1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_occluded RRM_7 Nup35_RRM_2 Calcipressin Nup35_RRM DbpA XOO_2897-deam
Motif
Other DBs
NCBI-GeneID: 312510
NCBI-ProteinID: NP_001012096
RGD: 1305742
Ensembl: ENSRNOG00000016813
UniProt: Q5PQR7
Position
4q34
AA seq 375 aa AA seqDB search
MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAA
AALAAMNGRKIMGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGR
ISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKS
TYESNTKQLSYDEVVSQSSPGNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGY
SFIRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPPAYGQWGQ
WYGNAQQIGQYVPNGWQVPAYGMYGQPWSQQGFNQTQSSAPWMGPNYSVPPPQGQNGGML
PNQPAGYRVAGYETQ
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgagatgcccaagactctatacgtcggtaacctttctcgagatgtgacagaa
gctctcatcctccagctctttagccagatcggaccttgtaaaaactgcaaaatgattatg
gatacggcaggaaatgacccgtactgtttcgtggagttccatgagcatcgccacgcagct
gcagccctggctgctatgaatgggcggaagataatgggtaaggaagtgaaagtgaattgg
gcaacaacccctagcagtcaaaagaaagatacaagcaatcatttccatgtgtttgttggt
gacctcagtccagaaatcacaactgaagacatcaaagcagcttttgcaccatttggaaga
atttcagatgcccgtgtggtaaaagacatggctaccgggaagtctaagggatatggcttt
gtctcctttttcaacaaatgggatgcagaaaatgccattcagcagatgggtggccagtgg
cttggtggaagacaaatcagaactaactgggcaacccgaaagcctccagctccaaagagt
acatatgagtcaaacaccaaacagctgtcatacgatgaggttgtgagtcagtctagtccc
ggcaactgtaccgtgtactgtggaggagtgacgtcaggactgacagaacaactaatgcgt
cagactttttctccatttggacaaataatggaaatccgagtctttccagataaagggtac
tcattcattcggttcagttcccatgaaagtgcggcacatgcaattgtttctgttaacggt
actaccattgaagggcatgtggtgaaatgttactggggcaaagagactcttgacatgata
aaccccgtgcagcagcaaaatcaaattggatatccaccagcatatggccagtggggccag
tggtatggaaatgcacaacagattggccagtatgtacctaatggttggcaagtacctgcc
tatggaatgtatggccagccatggagccagcagggattcaatcagacccagtcttctgca
ccatggatgggacccaattacagtgtgccgccacctcaagggcagaacggcggcatgctg
cctaatcagcctgctgggtatcgagtggcagggtatgaaacccagtaa

DBGET integrated database retrieval system