KEGG   Rattus norvegicus (rat): 312559
Entry
312559            CDS       T01003                                 

Gene name
Chchd4
Definition
(RefSeq) coiled-coil-helix-coiled-coil-helix domain containing 4
  KO
K17782  mitochondrial intermembrane space import and assembly protein 40
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    312559 (Chchd4)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    312559 (Chchd4)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Inter membrane space
   Mitochondrial intermembrane space assembly (MIA) complex
    312559 (Chchd4)
Transporters [BR:rno02000]
 Other transporters
  Primary active transporters [TC:3]
   312559 (Chchd4)
SSDB
Motif
Pfam: CHCH GCK Ndufs5
Other DBs
NCBI-GeneID: 312559
NCBI-ProteinID: NP_001013449
RGD: 1310746
Ensembl: ENSRNOG00000022466
UniProt: Q5BJN5
Position
4q34
AA seq 139 aa
MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGDINWNCPCLGGMA
SGPCGEQFKSAFSCFHYSTEDIKGSDCIDQFRAMQECMQKYPDLYPQDEEEEEEAKPVEP
VEETADTKASAAKEQGASS
NT seq 420 nt   +upstreamnt  +downstreamnt
atgtcctactgccggcaggaagggaaggatcggatcatatttgtgaccaaagaagaccat
gaaactcctagcagtgctgagctggtggctgatgaccccaatgatccctatgaagagcac
gggttgatactgcctaatggagacattaactggaattgcccatgtcttgggggaatggcc
agcggcccctgtggggagcagttcaagtctgccttttcctgcttccactacagcacagag
gatatcaagggatcagactgtatagaccagttccgggccatgcaggaatgcatgcagaaa
tacccagacctctatccccaagacgaggaggaggaagaggaggcaaagccagtggaacca
gtggaggaaacggctgacactaaggcctctgcagccaaagagcagggggcaagctcctga

DBGET integrated database retrieval system