KEGG   Rattus norvegicus (rat): 312652Help
Entry
312652            CDS       T01003                                 

Gene name
Plxnd1
Definition
(RefSeq) plexin D1
  KO
K06822  plexin D
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    312652 (Plxnd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Plexin_cytopl TIG Sema PSI TIG_plexin Insulin_TMD SIT
Motif
Other DBs
NCBI-GeneID: 312652
NCBI-ProteinID: NP_001101351
RGD: 1310796
Ensembl: ENSRNOG00000025209
UniProt: D4AA77
Position
4q42
AA seq 1716 aa AA seqDB search
MLNVAANHPNASTVGLVLPPASGTGGSRLLVGATYTGYGSAFFPRNRSLEDHRFENTPEI
SIRSLDARGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVRAFLHPAVPPHSAHPYAY
LALNSEARAGDKDSQARSLLARICLPRGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSRL
VSVFPAREQFFAVFERPQGTPGARNAPAALCAFRFADVQAAIRAARTACFLQPEQLDCGA
AHLQHPLTILQPLRASPVFRAPGLTAVAVANANNYTAVFLGTATGRLLKISLNESMQVVS
RRVLTVAYGEPVHHVMQFDPMDPGYLYLMTSHQMARVKVAACEVHSTCGDCVGAADAYCG
WCTLETRCTFKQDCANSSLPHFWTSASEGPSRCPAMTVLPSEIDVHRDYTGMILQISGSL
PSLSGMEMACDYGNGVRTVARVPGPAYGHQIAYCNLLPRAQFPPFPAGQDHVTVEMSVRV
KGHNIVSANFTIYDCSRIGQVYPHTACTSCLSTQWPCSWCIQLHSCVSNQSRCQDSPNPT
SPQDCPQIVPSPLAPVPTGGSQDILVPLTKAAFFHGTSLQCSFGLEENFEAVWANDSLVR
CNQVVLHTTQKSQVFPLSLKLKGPPDRFLDSPNPMTVVVYNCAMGSPDCSQCLGREDLGH
LCVWNDGCRLRGPLQPLSGTCPAPEIRAIEPLSGPLNGGTLLTIRGKNLGRRLSDVAHGV
WIGNVACEPLADRYTVSEEIVCATGPAPGAFSDVVTVNVSKEGRSREQFSYVLPRVHSLE
PSMGPKAGGTRITIHGSDLNVGSMLQVLVNDTDPCTDLTRTATSITCTVPRGTLPSPVPV
CVRFESRGCVHGNLTFWYMQNPVITAISPGRSPVSGGRTITVAGERFHMVQNVSMAVHHI
GREPTFCKVLNSTLIICPSPGALSNASAPVDFFINGRAYADEAAEELLDPAEAQRGSRFR
LDYLPNPQFSTAKREKWIKHHPGEPLTLVIHKEQDSLGLESHEYHIKIGQVSCDIQIISD
RVIHCSVNESLGTAEGQLPITIQVGNFNQTIATLQLGGSETAIVVSIVICSVLLLLSVVA
LFVFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFL
EYKHFVTRTFFPKCSSLYEERYVLPSKTLNSQGGSPPQETHPLLGEWNIPEHCRPSMEEG
ISLFSSLLNNKHFLIVFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKELLVD
LIDASAAKNPKLMLRRTESVVEKMLTNWMSICMYGCLRETVGEPFFLLLCAIKQQINKGS
IDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKILE
AFCKNVPYSQWPRAEDVDLEWFASSTQSYVLRDLDDTSVVEDGRKKLNTLAHYKIPEGAS
LAMSLTDKKDNTLGRVKDLDTEKYFHLVLPTDELVEPKKSHRQSHRKKVLPEIYLTRLLS
TKGTLQKFLDDLFKAILSIREDKPPLAVKYFFDFLEEQAEKRGISDPDTLHIWKTNSLPL
RFWVNILKNPQFVFDIEKTDHIDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIP
EYRKIVQRYYKQIQDMTPLSEQEMNAHLAEESRKYQNEFNTNVAMAEIYKYAKRYRPQIM
AALEANPTARRTQLQYKFEQVVALMENNIYECYSEA
NT seq 5151 nt NT seq  +upstreamnt  +downstreamnt
atgctcaacgtggccgccaaccaccccaacgcgtccaccgtgggactagtgctgccgccg
gcctccggcaccgggggcagccgtctgctcgtgggcgccacgtacaccggctacggaagc
gctttcttcccgcgcaaccgtagcctagaagaccaccgcttcgagaacacgcccgagatc
tctatccgctccctggacgcgcgtggagacttggctaagctcttcaccttcgacctcaac
ccgtcggacgacaacatactgaagatcaaacagggagccaaggagcagcacaagctgggc
ttcgtgcgtgccttcttgcacccggcggtgccaccgcacagcgcgcatccctacgcgtac
ctggcgctcaacagcgaggcgcgtgcgggcgataaagacagccaggcgcgcagcctgctg
gcgcgcatctgcctgccccgcggcgcgggtggcgacgccaagaagctcaccgagtcctac
atccaactgggcttgcagtgcgcgggcggcgcgggccggggtgacctctacagccgcctc
gtgtcggtcttccccgcgcgcgagcagttcttcgctgtcttcgagcggccccagggcacc
ccaggtgcccgcaacgccccggccgcgctctgcgccttccgcttcgccgacgtgcaggcc
gccattcgtgcagcgcgcaccgcctgctttctgcagccggagcagctggactgtggagca
gcccaccttcagcacccactgaccatcctgcagccactgagggcatcgccggtgttccgt
gctccagggctcacggccgtggctgtggccaatgctaacaactacacagctgtctttctg
ggcactgccacggggaggctcctcaagatcagcctgaatgagagcatgcaggtagtaagc
cggcgggtgctgactgtggcctacggggagcccgtgcaccatgtcatgcagtttgacccc
atggatcctggttacctgtacctgatgacatcccaccagatggcccgagtgaaggtggcg
gcgtgtgaggtacactccacctgcggggactgtgtgggcgcggccgatgcctactgtggc
tggtgtactctggagacccggtgcacattcaagcaggattgtgccaactccagcctgcca
catttctggaccagtgccagtgagggccccagccgctgccctgccatgacagtactgccg
tctgagattgatgtgcaccgggactacacgggtatgatcttacagatctcaggaagccta
cccagcctcagcggtatggagatggcttgtgactacggaaatggcgttcgaacagtggcc
cgagtacccggccctgcctatggtcatcagattgcctattgcaacctcctgcccagggcc
cagttcccaccctttcctgctggccaggaccacgtgactgttgagatgtctgtcagggtc
aaaggacacaacattgtctcagccaatttcaccatctacgactgcagccggattggacaa
gtctacccccatacagcctgtaccagctgcctgtcgacacagtggccttgctcctggtgc
atccagctgcactcctgtgtctccaaccagtctcggtgccaggactcaccaaaccctacg
agcccccaggactgtccccagatcgtgccctcgcccctggcacctgtgcccacgggtggc
tcgcaagacatcctggtgcctctgactaaggccgccttcttccatggcacctccctccag
tgcagctttgggctggaagagaactttgaggctgtgtgggcgaatgactcgctggtccgc
tgcaaccaagtggtgctgcatacaacccagaagagccaggtgtttccactgagcctgaag
ctgaaggggccacctgaccgattcctagatagtcctaaccccatgacagttgtggtctac
aattgtgctatgggcagccccgactgttcccagtgcctgggccgtgaggacctgggtcac
ctctgtgtttggaatgatggctgtcgtctgagagggcccctgcagccactctctggcacc
tgcccagctcctgaaatccgagcgattgagcctctgagtggccccttgaacggtgggacc
ttgctgaccatccgcggcaagaacctgggccgtaggctcagtgacgtggcacatggtgtg
tggattggcaatgtggcctgtgaacccctggctgacagatacacggtttcagaggagatc
gtgtgtgccacagggcccgccccaggggctttctcagacgtggtaacggtgaatgtctcc
aaggaaggcaggtctcgggaacagttctcctatgtgctgcccagggtccactcactggag
ccttccatgggcccaaaggcagggggcacaagaatcaccattcacggcagtgacctcaac
gtgggctccatgctccaggtcctggtgaacgacacggacccctgcacggatcttacgcgc
actgccaccagcatcacctgcactgtgccaaggggtaccctgccctctccagtgcctgtg
tgtgtgcgcttcgagagccggggctgcgtgcacggaaacctcaccttctggtacatgcag
aacccagtcatcacagccatcagcccaggccgcagccccgtcagtggcggcaggaccatc
accgtggctggcgaacgtttccacatggtacagaacgtatcaatggccgtacaccacatt
ggccgggagcccacgttctgcaaggttctcaactccacactcatcatctgcccatccccc
ggagccctgagcaatgcttcagcacccgtagacttcttcatcaatggccgggcctatgca
gacgaagcagctgaggagctgctggaccctgcagaggcacagcggggcagccggttccgc
ctagactacctccccaacccccagttctccacagccaagagggagaagtggatcaagcat
cacccaggagagccgctcaccctcgtcatccataaggagcaagacagcctggggctggag
agccatgagtatcacatcaagattggccaggtgtcctgtgacattcagatcatctcagac
agagtcatccactgctcagtcaacgagtcactgggcacggccgaagggcagctgcccatc
acaatccaggtggggaacttcaaccagaccatcgccaccctgcaactggggggcagcgag
acggccatcgtggtttccattgtcatttgcagtgtcctgttactgctgtctgtggttgct
ctgttcgtcttctgcaccaagagccgccgtgctgagcgctattggcagaagaccctgctg
cagatggaagaaatggagtctcagatccgagaggagatccgcaaaggctttgcggagctg
cagacagatatgacagatctcaccaaggagctgaaccgcagccagggcatccccttcttg
gagtacaagcactttgtgactcgtaccttcttccccaagtgctcttccctctatgaagag
cggtatgtgctgccctcgaagaccctcaactcccaaggtggctcccctccacaggaaacc
cacccactgctgggagagtggaatatccctgaacactgtcggcccagcatggaggaggga
atcagtctgttctcctcgctgctcaacaacaagcacttccttattgtctttgttcatgct
ctggagcagcagaaggacttcgctgtgcgtgacaggtgcagcctggcatcactgttgacc
attgcactgcatggcaagctggagtactacacgagcatcatgaaggagctgctggtggat
ctcatcgacgcctcagcagccaagaaccccaagctcatgttgcggcgcaccgagtccgtg
gtggagaagatgcttaccaactggatgtccatctgcatgtatggctgcctgagggaaaca
gtaggtgagccgttcttcctgctgttatgcgccatcaagcagcagatcaacaaaggttcc
atcgacgccatcacaggcaaagcccgatacacacttaatgaggagtggctgctgagagag
aacattgaggccaagccccggaacctgaacgtgtccttccagggctgtggtatggattca
ctgagcgtgcgggccatggacactgacacgctgacgcaggtgaaagagaagatcctggaa
gccttctgcaagaatgtaccgtactcgcagtggccgcgggcggaggacgtggacctcgaa
tggtttgcctcaagcacccagagctacgtcctccgggacctggatgacacgtcagtggtg
gaggacggccgtaagaaactgaacacgctagcccactacaagatacctgagggtgcctcc
ctagccatgagcctcacagacaagaaggacaataccctgggccgagtgaaagacttggac
acagaaaagtatttccatttggtgctacctacggatgagctggtagagcctaagaagtct
caccggcagagccaccgcaagaaagtgttgccagagatctacctgacccgcctgctgtcc
accaagggcacactgcagaagttcttggatgatttgttcaaggctatcctgagcatccga
gaggataagcccccgctggccgtcaagtatttctttgacttcctagaggaacaggcggag
aagagaggcatctctgaccctgacaccttgcacatctggaagaccaacagccttcccctc
cgcttctgggtgaacatcttaaaaaatccccagtttgtcttcgacatagagaagacagac
cacatcgatgcctgcctgtctgtcatcgcccaggccttcatagatgcctgctccatctct
gacctgcagctgggcaaggactcacccaccaacaagcttctgtacgcgaaggagatcccc
gagtaccggaagattgtacagcgctattacaaacagatccaggacatgacgccactcagc
gagcaggaaatgaacgcacacctggctgaggagtcccggaaataccagaatgagttcaac
acaaatgtggccatggctgagatctataaatatgctaagaggtatcgcccacagatcatg
gctgccctggaggccaaccccactgcccgcaggacccagctgcagtacaagtttgaacag
gtggtcgctctgatggaaaataatatctatgagtgttacagcgaggcctga

DBGET integrated database retrieval system