KEGG   Rattus norvegicus (rat): 312689Help
Entry
312689            CDS       T01003                                 

Gene name
M6pr
Definition
(RefSeq) mannose-6-phosphate receptor, cation dependent
  KO
K10089  cation-dependent mannose-6-phosphate receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04145  Phagosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    312689 (M6pr)
   04142 Lysosome
    312689 (M6pr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    312689 (M6pr)
   04091 Lectins [BR:rno04091]
    312689 (M6pr)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   312689 (M6pr)
Lectins [BR:rno04091]
 P-type lectins
  312689 (M6pr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Man-6-P_recep ATG27 CIMR CymA
Motif
Other DBs
NCBI-GeneID: 312689
NCBI-ProteinID: NP_001007701
RGD: 1359355
Ensembl: ENSRNOG00000059373
UniProt: Q6AY20
Position
4q42
AA seq 278 aa AA seqDB search
MFPLSGCWRTELLLLLLLAVAVRESWQIEEKSCDLVGEKDKESKNEVALLERLRPLFNKS
FESTVGQGSDTYSYIFRVCREAGNHSSGAGLVQINKSNEKETVVGRINETHIFNGSNWIM
LIYKGGDEYDNHCGKEQRRAVVMISCNRHTLAGNFNPVSEERGKIQDCFYLFEMDSSLAC
SPEVSHLSVGSILLVIFASLVAVYIIGGFLYQRLVVGAKGMEQFPHLAFWQDLGNLVADG
CDFVCRSKPRSVPAAYRGVGDDQLGEESEERDDHLLPM
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgttccctctctctggctgttggaggactgaactgttactgttgctactcctggctgtg
gctgtgagagaatcctggcagatagaagaaaaatcgtgtgacctggtaggagaaaaggat
aaggagtcaaagaatgaggtggctctcctggagaggttacggccactgtttaacaaaagt
tttgagagtactgtgggccagggctcagacacttacagctatatattcagagtatgccgg
gaagctggcaaccactcctctggcgcaggcctggtccagatcaacaaaagtaatgagaag
gaaacggtggttgggagaatcaacgagactcacatcttcaatggaagtaactggatcatg
ttgatatataaagggggtgacgaatatgacaaccactgtggcaaagaacagcgccgtgca
gtggtgatgatctcctgcaatcgacacacactcgcgggtaattttaacccagtgtctgag
gaacgcggcaaaatccaggattgcttctacctctttgagatggatagcagcctagcctgt
tcaccagaggtctcacacctcagtgtgggctccatcctccttgtcatatttgcatcattg
gttgctgtttacatcattgggggtttcttataccagcgactggtagtgggggccaagggg
atggagcagtttcctcatctggccttctggcaggatcttggcaacctagtagctgatggt
tgtgactttgtgtgccgttccaaaccccgcagtgtgcctgcggcctatcgtggcgtcggg
gatgaccagctgggggaagagtcagaagaaagggatgaccatttgctaccaatgtga

DBGET integrated database retrieval system