KEGG   Rattus norvegicus (rat): 312703
Entry
312703            CDS       T01003                                 

Gene name
Pex5, PTS1-BP, PTS1R
Definition
(RefSeq) peroxisomal biogenesis factor 5
  KO
K13342  peroxin-5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    312703 (Pex5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    312703 (Pex5)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    312703 (Pex5)
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_11 TPR_8 TPR_17 TPR_14 TPR_16 TPR_19 TPR_12 TPR_7 TPR_9 TPR_10 TPR_20 ANAPC3 DUF1641
Other DBs
NCBI-GeneID: 312703
NCBI-ProteinID: NP_001164055
RGD: 1307612
Ensembl: ENSRNOG00000049203
UniProt: Q2M2R8 M0R4L3
Position
4q42
AA seq 604 aa
MAMRELVESECGGANPLMKLATHFTQDKALRQEGLRPGPWPPGASAAETVSKPLGVGTED
ELVAEFLQDQNATLVSRAPQTFKMDDLLAEMQEIEQSNFRQAPQRAPGVADLALSENWAQ
EFLAAGDAVDVAQDYNETDWSQEFIAEVTDPLSVSPARWAEEYLEQSEEKLWLGDPEGTS
TTDRWYDEYHPEEDLQHTASDFVSKVDDPKLANSEGTSEAWVDQFTRPGNKLAALQVEFE
RAKSAIESDVDFWDKLQAELEEMAKRDAEAHPWLSDYDDLTSASYDKGYQFEEENPLRDH
PQPFEEGLRRLEEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRC
LELKPDNRTALMALAVSFTNESLQRQACETLRDWLRYSPAYAHLVAPGEEGASGAGLGPS
KRVLGSLLSDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAAL
SVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREA
VEHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLPALLTMF
GLPQ
NT seq 1815 nt   +upstreamnt  +downstreamnt
atggcaatgcgggagctggtggagagcgaatgtgggggtgccaacccgctgatgaagctg
gccacccacttcacccaggacaaggcccttcggcaggagggactgaggcctggcccctgg
cctccaggagcctcagcggcggaaacggtttccaagcctttgggagtaggcactgaagat
gagttggtggcagaattcctgcaggaccagaatgcaactcttgtatcccgagcccctcag
accttcaagatggatgacctcttggcggagatgcaggagattgaacagtcaaactttcgc
caggctcctcagagagcccctggtgtggcagacttggctttgtctgagaattgggcccag
gagtttcttgccgctggagatgctgtggatgtagctcaggattataacgagaccgactgg
tcccaagaattcatcgccgaagtcacggaccctctgtctgtgtccccagcccgatgggct
gaggagtatctggaacagtctgaggagaagctgtggttgggagatccagaaggaacctct
accactgaccgatggtacgatgaataccatcctgaggaggatctgcagcacacagccagt
gactttgtgtccaaggtggacgaccccaaattggctaactctgagggcacatcggaggcc
tgggttgatcagttcacaagaccaggaaacaaactggctgctcttcaggtggaatttgaa
cgagccaagtcagctatagagtcagacgtcgatttctgggacaagttgcaggcagagttg
gaggagatggcaaaacgggatgctgaggcgcacccctggctttctgactatgacgacctc
acgtctgcttcctatgacaagggctaccagtttgaggaggagaatcccttgcgtgaccac
cctcagccttttgaagaagggctgcgtcgacttgaggagggagacctgcccaatgctgtg
ctgctcttcgaggctgcggtgcagcaggatcctaagcacatggaggcctggcagtacctg
ggcaccactcaggctgagaacgagcaagagctcttggccatcagtgccctgcgcaggtgt
ctggagctaaagccagataaccggacagcactgatggcgctggctgtaagcttcaccaat
gagtccctgcagcggcaagcctgtgagacgctgcgggactggctgcgctactcaccggcc
tacgctcacctggtggctcctggtgaagaaggggctagtggggcaggactgggtcccagc
aagcgcgtcttgggatctctgttgtctgactccctgtttcttgaagtaaaagaactcttc
ctggcagctgtgcgtctggaccctacatccattgaccctgacgtgcagtgtggcctggga
gtcctcttcaacctgagtggggagtacgacaaggctgtggactgtttcacggctgccctc
agtgtccgccccaatgactatttgctgtggaacaagcttggggccaccctggccaacggg
aaccagagtgaagaagcagtggctgcttaccgcagagcccttgaactacagcctgggtac
atccgctcccgctacaacctaggcatcagctgcatcaaccttggggctcaccgtgaggcc
gtggaacactttctggaggccctgaacatgcagaggaagagccggggccctcggggtgag
gggggcgccatgtctgagaacatctggagtactctgcggttggcattgtccatgctaggc
cagagtgatgcctatggggcagccgatgctcgggacctgcctgcccttctaactatgttt
ggcctgccccagtga

DBGET integrated database retrieval system