KEGG   Rattus norvegicus (rat): 312711Help
Entry
312711            CDS       T01003                                 

Gene name
Pianp, PANP, RGD1304952, leda-1
Definition
(RefSeq) PILR alpha associated neural protein
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: AJAP1_PANP_C
Motif
Other DBs
NCBI-GeneID: 312711
NCBI-ProteinID: NP_001014081
RGD: 1304952
Ensembl: ENSRNOG00000017052
UniProt: Q5U2P6
Position
4q42
AA seq 272 aa AA seqDB search
MWPAQLLSQLLPLWPLLLLPLSLPAQGSSHRSPPAPARPPCVRGGPSAPRHVCVWERAPP
PSRSPRVPRSRRQVLPGTAPPATPSGFEEGPPSSQYPWAIVWGPTVSREDGGDPNSVNPG
FLPLDYGFAAPHGLATPHPNSDSMRDDGDGLILGETPATLRPFLFGGRGEGVDPQLYVTI
TISIIIVLVATGIIFKFCWDRSQKRRRPSGQQGALRQEESQQPLTDLSPAGVTVLGAFGD
SPTPTPDHEEPRGGPRPGMPQPKGAPAFQLNR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtggcctgctcaactgctgtcccaactcctccctctctggccactgctgttgctaccc
ctatcactgcctgctcagggctcctcccatcgatcccccccagccccagcccgtcccccc
tgcgtccggggtgggccctcagcccctcgccacgtgtgtgtttgggagcgggcgcctcca
ccaagccgatccccacgggtcccaagatcacgtcggcaagttctgccaggcactgcaccc
cctgctactccatcaggctttgaggaggggcctccctcctctcagtacccttgggccata
gtgtggggtcccacagtatctcgggaggatggaggggaccccaactctgtcaatcctgga
tttctgcccctggactatggttttgcagccccacatgggctggctactccgcaccccaac
tcagactccatgcgggatgatggagacgggctcatccttggggaaacacctgccaccttg
aggcccttcctgtttggagggcgcggagaaggtgtggaccctcagctttacgtgacaatt
accatatccatcatcattgttcttgtggcgactggcatcatcttcaagttctgctgggac
cgtagccagaagcggcgcaggccctcagggcagcaaggtgccctgaggcaggaagagagc
cagcaaccactgacagacctgtctcctgctggagtcactgtgctgggggcttttggggac
tcacctacccccacccctgatcatgaggaaccccgagggggaccccggcctgggatgccc
cagcctaagggggctccagccttccagttgaaccggtga

DBGET integrated database retrieval system