KEGG   Rattus norvegicus (rat): 312721
Entry
312721            CDS       T01003                                 

Gene name
Dyrk4
Definition
(RefSeq) dual specificity tyrosine-phosphorylation-regulated kinase 4 isoform X1
  KO
K18669  dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    312721 (Dyrk4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     312721 (Dyrk4)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   312721 (Dyrk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kinase-like APH
Other DBs
NCBI-GeneID: 312721
NCBI-ProteinID: XP_038964750
RGD: 1306800
Ensembl: ENSRNOG00000053178
Position
4
AA seq 649 aa
MQLLPLPALTWTETKMDTNKARKRSLTTFPVLKARKKQSFTSVKGPTLPPDIYMVESKPL
VQLQKPSSKTKKLRSNRCSQKNPSTSSSAFPFVDTKGKKNTVNFPHIGNKTLPKGSTLYQ
ENQIHNQLLSSELKTSEIPFSFSTKAQDTKVQDTKLHPELPKRHKVPLTAAEALKFFKNQ
LSPYEQSEILGYSELWFLGLDAKKLNVVPEKFSKTSFDDEHGSYVKVLHDHIAYRYEVLD
MIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFHHQALVELKILEALRRKDKDNTHNVVH
MKDFFYFRNHLCITFELLGINLYELMKNNSFQGFSLSIVRRFTLSVLKCLQMLYVEKIIH
CDLKPENIVLYHRGQVTVKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYNMAIDMW
SLGCIMAELYTGYPLFPGENEVEQLACIMEVLGLPPTHLIQTATRRQIFFDSKGLPKNIT
NNRGEKRYPNSKDLPMVVKTYDSSFLDFLRRCLVWEPSLRMTPDQALKHAWIHEPRKFKP
WPRPQIQRKPGVSSSSETSKDKTEEHQASKGTKDEATKETTDKLKDEPEKHPESSCKRQS
SIQHLANTVQLPNLAEASGKPEAVAGSETSEEQQCTSSPKSTNILPPIM
NT seq 1950 nt   +upstreamnt  +downstreamnt
atgcagctcctcccacttcctgccctcacctggacagagactaaaatggatacgaacaag
gcaaggaaacgtagtttgacaaccttcccagttttgaaagcaagaaagaagcagagtttc
acctccgtgaagggtcccactcttcctcctgatatctacatggttgagagtaagcctttg
gttcaactccagaagccatcctccaagaccaagaagctgagatcaaaccgatgttcacaa
aagaatccaagtaccagcagcagtgcattcccttttgtggacacaaaggggaagaagaac
acagttaacttcccccacattggcaacaaaaccctaccaaaggggtccacattgtatcag
gaaaatcagattcataatcaactgctgtcctctgaactcaagacctcagaaatacctttt
agctttagcaccaaagcccaagacaccaaagtccaagacaccaagctccatccagaacta
ccaaagaggcacaaagtccctcttacagcagcagaggccctaaagttttttaagaatcag
ctgtccccttatgaacaaagcgaaatcctgggctactcggagctgtggttcctagggctt
gatgccaagaagctcaacgtggttccggagaagttcagcaagacaagctttgatgacgag
cacggttcctatgtcaaggtcctgcatgaccacattgcctaccgatacgaggttctggat
atgatcgggaaagggtcctttggacaggtggccaagtgcttggatcacaaaaacaatgag
ttggtggccctgaaaatcataaggaacaaaaagagatttcaccatcaggctctggtggag
ctgaagatcctggaggccctcagaagaaaggacaaagacaacacccacaacgtagtccac
atgaaggacttcttctacttccggaatcacctctgtatcacctttgaactcctgggaatc
aacctgtatgagttgatgaagaataacagctttcaaggcttcagtctgtccatagttcgg
cgcttcaccctttctgttttgaaatgcttacaaatgctttatgtagagaaaatcatccac
tgtgacctcaagccggaaaatattgtgctgtaccaccggggccaagtcactgttaaagtt
attgactttgggtcaagctgctatgaacaccagaaagtttatacatacatccaaagccgg
ttctaccgatcccccgaggtgattctgggccacccctataacatggccattgatatgtgg
agcctgggctgtatcatggctgagctgtacaccggatacccactgttccctggggagaac
gaggtggagcagctggcttgcatcatggaggtgctgggcctgccacctacccacctcatc
cagacagccaccagaagacagatattcttcgattccaaaggtcttcccaaaaatataacc
aacaacagaggggaaaaaagatacccgaattccaaggacctcccgatggtggtgaaaacc
tatgactccagcttcctggactttctcagaaggtgtttggtgtgggagccttctctgcgc
atgacccctgaccaggccctcaagcatgcctggattcacgagccgaggaaattcaaacca
tggcccaggcctcagatccaaaggaagcctggtgtgagtagctcctctgagacaagcaag
gacaagactgaagagcaccaggccagcaaaggcacaaaagatgaggccaccaaagaaact
acagacaagttgaaagatgagcctgagaagcaccctgagagttcgtgcaaacggcagagc
tctatccagcacttagccaacacagtccagctgcctaatctagcagaagcttctggaaag
ccagaggctgttgctgggtcagagacgtccgaagaacaacaatgcacctcctcccccaag
agcacaaacattttaccacccatcatgtga

DBGET integrated database retrieval system