KEGG   Rattus norvegicus (rat): 312897Help
Entry
312897            CDS       T01003                                 

Gene name
Msc
Definition
(RefSeq) musculin
  KO
K09072  musculin (activated B-cell factor-1)
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    312897 (Msc)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Mesodermal Twist-like factors
    312897 (Msc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Pep1_7
Motif
Other DBs
NCBI-GeneID: 312897
NCBI-ProteinID: NP_001178683
RGD: 1305496
Ensembl: ENSRNOG00000007540
UniProt: D3ZWP1
Position
5q11
AA seq 203 aa AA seqDB search
MSTGSVSDPEDTEMRGLQRVYPAPASKRPPLLRPERSYASPSDNSSAEEEDPDGEEEPGT
VGAAGGCKRKRPRGADASGAGGGAGSTGKKALPPKGSAAECKQSQRNAANARERARMRVL
SKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYEDSYVHPVNLTWPFV
VSGRPDSDTKDVSAANRLCGTSA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccggctcggtgagtgaccccgaagacacggagatgcgggggctgcagcgggtc
tacccggcccccgcctccaagaggccacccctgctccgcccggagcgcagttacgcctcg
cccagcgacaactcttcggcggaggaggaggaccccgacggcgaagaggagccgggcacc
gtgggagccgcgggaggctgcaagagaaagcggccccgtggggctgacgccagcggcgca
ggtggcggtgcgggcagcaccgggaagaaggcgctcccgcccaagggctcggccgccgag
tgcaagcagtcacagcggaacgcggccaacgcccgcgaacgcgcccggatgcgcgtgctg
agcaaagctttctccagactcaagaccagcctgccttgggtgccgccggacaccaagctt
tccaaactggacacgctgcgtttggcttccagctacatcgcgcacctgcgccagctgctg
caggaggaccgctacgaggatagctatgtgcaccccgtgaacctgacgtggccattcgtg
gtctctggacgcccagactctgataccaaagatgtttctgcagccaacaggctttgtgga
acttcagcttag

DBGET integrated database retrieval system