KEGG   Rattus norvegicus (rat): 312915Help
Entry
312915            CDS       T01003                                 

Gene name
Arfgef1, BIG1, RGD1560793
Definition
(RefSeq) ADP ribosylation factor guanine nucleotide exchange factor 1
  KO
K18442  brefeldin A-inhibited guanine nucleotide-exchange protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    312915 (Arfgef1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    312915 (Arfgef1)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    312915 (Arfgef1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 Sec7_N DCB DUF1981
Motif
Other DBs
NCBI-GeneID: 312915
NCBI-ProteinID: NP_001263985
RGD: 1560793
Ensembl: ENSRNOG00000005703
UniProt: D4A631
Position
5q11
AA seq 1846 aa AA seqDB search
MYEGKKTKNMFLTRALEKILADKEVKKAHHSQLRKACEVALEEIKVETEKQSPPHGEAKA
GSGTLPPVKSKTNFIEADKYFLPFELACQSKCPRIVSTSLDCLQKLIAYGHLTGSAPDST
TPGKKLIDRIIETICGCFQGPQTDEGVQLQIIKALLTAVTSQHIEIHEGTVLQAVRTCYN
IYLASKNLINQTTAKATLTQMLNVIFARMENQALQEAKQMERERHRQQHHLLQSPVSHHE
PESPHLRYLPPQTVDHIAQEQEGDLDPQTHDVDKSLQDDIEPENGSDISSAENEQTEADQ
ATAAETLSKDDVLCDGECEEKPQDIVQSIVEEMVDIIVGDMGEGTAVSASADGNAGAVED
GSDSENVQANGIPGTPISAAYTPSLPDDRLSVSSNDTQESGNSSGPSPGAKFSHILQKDA
FLVFRSLCKLSMKPLSDGPPDPKSHELRSKILSLQLLLSILQNAGPVFRTNEMFINAIKQ
YLCVALSKNGVSSVPEVFELSLSIFLTLLSNFKTHLKMQIEVFFKEIFLYILETSTSSFD
HKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRGSQELGMSNV
QELSLRKKGLECLVSILKCMVEWSKDQYVNPNSQTTLGQEKPSEQEISEIKHPETINRYG
SLNSLESTSSSGIGSYSTQMSGTDNPEQFEVLKQQKEIIEQGIDLFNKKPKRGIQYLQEQ
GMLGTTPEDIAQFLHQEERLDSTQAGEFLGDNDKFNKEVMYAYVDQHDFSGKDFVSALRL
FLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQV
KNKMTKEQYIKMNRGINDSKDLPEEYLSAIYNEIAGKKISMKETKELTIPTKSTKQNVAS
EKQRRLLYNLEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVRPMFKLAWTPFLAAFSVG
LQDCDDTDVASLCLEGIRCAIRIACIFSIQLERDAYVQALARFTLLTVSSGITEMKQKNI
DTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKPRYISGTVRGREGSLTGT
KDQAPDEFVGLGLVGGNVDWKQIASIQESIGETSSQSVVVAVDRIFTGSTRLDGNAIVDF
VRWLCAVSMDELLSTTHPRMFSLQKIVEISYYNMGRIRLQWSRIWEVIGDHFNKVGCNPN
EDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKRNRSPTIRDMVVRCIAQM
VNSQAANIRSGWKNIFSVFHLAASDQDESIVELAFQTSGHIVTLVFEKHFPATIDSFQDA
VKCLSEFACNAAFPDTSMEAIRLIRHCAKYVSDRPQAFKEYTSDDMNVAPEDRVWVRGWF
PILFELSCVINRCKLDVRTRGLTVMFEIMKTYGHTYEKHWWQDLFRIVFRIFDNMKLPEQ
QTEKAEWMTTTCNHALYAICDVFTQYLEVLSDVLLDDIFAQLYWCVQQDNEQLARSGTNC
LENVVILNGEKFTLEIWDKTCNCTLDIFKTTIPHALLTWRPTSGEAAPPSPSAMSEKQLD
AISQKSVDIHDSAQPRSSDNRQQAPLVSVSPASEEVSKGRPTAKFPEQKLFAALLIKCVV
QLELIQTIDNIVFFPATSKKEDAENLAAAQRDAVDFDVRVDTQDQGMYRFLTSQQLFKLL
DCLLESHRFAKAFNSNNEQRTALWKAGFKGKSKPNLLKQETSSLACGLRILFRMYTDESR
VSAWEEVQQRLLNVCSEALSYFLTLTSESHREAWTNLLLLFLTKVLKISDNRFKAHASFY
YPLLCEIMQFDLIPELRAVLRRFFLRIGIVFQISQPPEQELGINKQ
NT seq 5541 nt NT seq  +upstreamnt  +downstreamnt
atgtatgagggcaagaagacgaagaacatgttcctgacccgggccctggagaagattttg
gccgacaaggaagtgaagaaggcgcatcactcccagctgcgcaaagcgtgcgaggtggcc
ctagaggaaataaaagttgaaactgagaaacaaagtcctcctcatggagaagcaaaagct
ggatcaggcacccttccaccagtgaaatcaaagacaaattttattgaagcagacaagtac
ttcttaccctttgagttggcatgccagtccaaatgtccccgcatagttagtacatctcta
gactgtttgcagaaacttattgcttatgggcacttgactggcagtgctccagatagtacg
acaccaggcaaaaagttaattgatagaattattgaaacaatatgtggctgcttccaaggc
cctcaaacagatgaaggagttcagttgcagataataaaggctttacttactgcagtaaca
tcacaacacatagaaattcacgaaggaactgtgctgcaagctgtgaggacatgctacaat
atctatttagccagcaaaaatctcatcaatcagacaacagccaaagctactcttactcag
atgctaaatgttatctttgcacgcatggaaaaccaagcattacaggaagccaaacaaatg
gaaagagaaagacatcggcagcagcatcacttgttacagtctccagtaagccatcacgag
cccgagtcacctcatcttagatatttgccacctcagactgttgatcatatagcccaagaa
caggaaggggatcttgatccccaaacacacgatgtggataaaagtctccaagatgacata
gagcctgagaacggatctgatatttccagtgcagagaatgaacagacagaagctgatcag
gcaactgcagctgaaacattatctaaagatgatgtgttgtgtgatggagagtgtgaggaa
aagccacaggatattgtgcagagcattgtggaagagatggtggacatcattgttggagac
atgggggaaggaacagctgtaagtgcaagtgcagatggcaacgctggagctgtagaggat
ggcagtgacagtgagaacgtgcaagccaatgggatcccgggaacacccatctctgccgca
tacacaccatcgttacctgacgacagattgtctgtctcctccaatgatactcaggaatct
ggaaattcttcaggaccttcacctggtgctaagttttcccacattttacaaaaggatgcc
tttctagtgttcaggtcattgtgtaagctgtcaatgaaaccactgtcagatggaccacca
gatccaaagtctcatgagttacggtccaagattctttcattgcagttgcttctgtccatt
ctgcagaatgcaggacctgttttcaggacaaatgagatgtttattaatgctatcaagcag
tatctgtgtgttgcactctcaaaaaacggagtctcatctgttccagaggtttttgagctt
tctctttccatatttctaactttgttgtcaaacttcaagacacatctgaagatgcaaatt
gaggtattctttaaagaaattttcctgtacattttggaaacttctacaagctcatttgat
cataagtggatggtgattcagacactgacaaggatctgtgcagatgctcagagtgtggtg
gatatttatgtaaattatgactgtgacttgaatgcagcaaatatatttgaaagactagta
aatgacctgtcaaaaattgcccaaggaaggggcagtcaagaacttgggatgagtaatgtt
caggaattgagcctgcggaaaaaggggttagaatgtttagtttcaattcttaagtgtatg
gttgaatggagtaaggatcagtacgtgaatcccaactctcaaaccacccttggtcaggaa
aaaccctcagagcaagagataagtgaaatcaaacaccccgagactataaacagatatgga
agtttaaactccttagaatccacatcatcttcagggattggcagctacagcacacagatg
tctggcactgataatccagaacaattcgaggtcctaaagcagcaaaaagaaataatagaa
caagggattgatttatttaataagaaaccaaagagaggaatacagtacctccaagaacaa
gggatgcttggcaccactcctgaagatatagctcagttcttacatcaagaagaaagatta
gactctacacaggcgggggagttcctgggagataacgataagttcaataaggaagtcatg
tatgcatatgtagaccagcatgacttttcgggaaaagactttgtttcagctcttcgtctg
tttctggaaggattccggcttccaggagaagctcagaaaattgatcgattaatggaaaaa
tttgctgcaagatacctagagtgcaaccaaggacaaaccctttttgctagtgcagatact
gcttatgttttggcctactcaattatcatgttgaccacagaccttcacagtccacaggtt
aaaaacaaaatgacgaaagaacagtatattaaaatgaatcgtggtatcaatgacagtaaa
gatctccctgaagagtatctatctgccatttataatgagatagctgggaaaaaaatatca
atgaaagaaacaaaagaactaacaatccctacaaaatcaactaaacagaatgtagccagt
gaaaagcaaagacgacttctgtataatttagaaatggaacagatggccaagacagctaaa
gcactcatggaagctgtgagccatgttcaggcaccttttacaagtgcaacacacttggag
cacgtgaggcctatgtttaagttggcttggaccccttttctggctgccttcagtgtgggt
ctacaagactgtgatgatactgacgtggcctctctctgcctcgaagggatacgatgtgcg
atcagaattgcatgcatcttcagcattcagctggaaagagatgcatatgtccaggcacta
gccagatttaccttacttacagtgagttctggtattactgaaatgaaacagaagaatatc
gacacaataaaaacactcatcacagtggctcacacagatggaaattatttaggaaattcg
tggcatgagatcctgaagtgcattagtcagttagagcttgcacaacttataggaactgga
gtgaagcctcggtacatttctgggaccgtgagaggcagagaagggtctctcactgggaca
aaagatcaggctccggatgaatttgttggtctggggctagttggaggaaatgtggactgg
aagcagatagccagtattcaggagtctattggagaaaccagttctcaaagtgtcgtggtt
gctgtagacagaatattcacaggatccacaaggctagatggaaatgctattgtcgatttt
gttcgttggctctgtgccgtgtctatggatgaattgctttccactacacacccaagaatg
tttagtctacaaaaaatagtagaaatatcatactataacatgggaagaataagactgcag
tggtctcggatttgggaagttattggagatcattttaataaggttggttgcaatcctaat
gaagatgtagccatatttgcagtagactccctgaggcagctatcgatgaagtttttagag
aaaggagagcttgcaaacttcagattccaaaaggatttcttaagaccttttgaacatata
atgaaacgaaacaggtctccaacaattcgagatatggtcgtgcgttgtatagcgcagatg
gttaactctcaggctgccaatatccgttcaggatggaagaacattttctcggtgttccac
ctagctgcatcagaccaggatgagagcatagtagagctagcattccagacgagcgggcac
atcgtcactcttgtatttgaaaagcactttccagccactattgattctttccaggatgca
gtgaagtgtttatctgaatttgcgtgtaatgcggctttcccagacacaagtatggaagca
atccgacttattcgccattgtgcaaaatatgtgtctgatagacctcaggctttcaaagag
tacacaagtgatgacatgaacgtggcacctgaagacagggtgtgggtgagagggtggttc
ccaatcctctttgagttgtcctgtgtcatcaatagatgcaaattagatgtaagaaccagg
ggcttaacagtgatgtttgaaataatgaaaacatacggccacacttacgaaaaacactgg
tggcaggacttgttcagaattgttttcagaatctttgacaacatgaagttgccagaacag
cagacagagaaagctgaatggatgacaacaacttgtaaccatgccctttatgcgatatgc
gacgtgttcacccagtatttagaagtcctcagtgatgtacttttggatgatatttttgcc
cagctttactggtgtgtacaacaagacaatgagcagttagcacgatctggtacgaactgc
ttagaaaatgtggttattctgaatggtgagaagtttactctagaaatctgggataaaacc
tgtaattgcaccctggatatcttcaaaaccacaattcctcatgcgcttctgacttggcgt
cctacttctggagaggctgcccccccatctccatcagctatgagtgaaaagcagttggat
gcaatatcacagaaatctgtagacatacatgattctgctcaaccaagatcttcagataac
aggcagcaagcaccacttgtttctgtttctcctgcgagtgaagaagttagcaaagggaga
cccacagcaaaattcccagaacaaaaattgtttgctgccctgttgattaaatgtgttgtg
cagctggaactcatccagaccatcgacaacattgtgttcttcccagccacaagcaagaag
gaagatgcagaaaacttagctgcagcccagagagatgcagtggacttcgatgttcgagtt
gatactcaagaccaaggaatgtaccgctttttaacatcacaacaactcttcaagctactg
gactgcttattagagtcacatagatttgcaaaagcatttaattccaacaatgaacagagg
actgctctatggaaagcaggcttcaaaggcaagtccaagcccaatctcctaaaacaagag
acaagcagcctggcgtgtggactgcgcatcctcttccggatgtacacagacgagagcaga
gtcagcgcctgggaggaggtccagcagaggcttttaaacgtctgcagtgaggcactgagt
tacttcctcactctaacatctgaaagtcaccgggaagcctggaccaacttactgttactg
ttcctcactaaagtcctcaagatcagtgacaacaggtttaaagctcacgcatcattctac
taccctctgttatgtgaaattatgcaatttgacttgattcctgaacttcgtgctgttctt
agaagatttttcctgcgaattggaatagtatttcagatatcacaaccacctgaacaggaa
cttgggataaacaagcaatga

DBGET integrated database retrieval system